KEGG   Cellulosilyticum lentocellum: Clole_3703Help
Entry
Clole_3703        CDS       T01448                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Clole_3703
Enzymes [BR:cle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Clole_3703
Peptidases [BR:cle01002]
 Cysteine Peptidases
  Family C44
   Clole_3703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4049160..4050998
Genome map
AA seq 612 aa AA seqDB search
MCGFAGIVDFKKILTNEQVHLESMTDTLKMRGPDQHGYKSYPHVLFGHRRLIVVDPKGGL
QPMTKEQGGFQYTLIYNGELYNTEDIRKELLNNGYQFDSYSDTEVLLTAYMCWGVNCVEK
LNGIFAFAVYDEKLEQVLLVRDQLGVKPFFYSIQGTTLIFGSEIKTVLAHPAVSPTVDRE
GLTEIFGLGPAVRPGSAVFKEISELSPAHLAIINKKDIVIKEYWQLRATENHETLSEATE
HLQHLLIDAIERQLVGDVPLCTFLSGGLDSSAISAIAARSYQKRNKVLTTYSLDYEDNDK
YFKASIYQPTSDQYWALQMAEFIQSNHRTYTIKHDELAYALKSAVLARDLPGMADIDSSL
FLFCKEIREDFIVALSGECADEVFGGYPWYTRPELRNLETFPWSNFVRSRKQLLSPEYAS
LPLEEIVQENYLDSLKLVPQLGYESLERQRTREIFYLNMKWFMVNLLNRKDRMSMANSLE
VRVPFADYRLVEYAFNLPDDYLFYQGREKGLLRKALKGILPEDIIYRKKSPYPKTHNPIY
TQLVSNMLSEVLQNKNAPLFTIINKEFAQKLVDTKGEAYTRPWFGQLMTGPQLIAYLVQL
NIWLESYKVKLV
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggttttgctggtattgtagatttcaaaaaaattcttactaatgaacaggttcat
ctagaaagcatgactgataccttaaaaatgcgcggccctgatcaacatggctataaatct
tatcctcatgttctctttgggcacagaagactcattgttgtagatcccaaaggtggtctt
caacctatgactaaagaacaaggtggctttcagtacacccttatttacaatggcgaactt
tacaatacagaagatattagaaaagaactccttaataatgggtaccaatttgattcttac
tcagatactgaagtgcttttaacagcttacatgtgttggggcgttaattgcgtcgaaaag
cttaatggtatatttgcttttgcagtttatgatgaaaaacttgagcaggttttattagta
cgtgatcaactaggcgttaaacctttcttttatagcattcaaggcaccactcttattttt
ggttcagaaattaaaacagttttagcgcatcccgctgtttctcctaccgtggacagagaa
ggacttacagaaatattcggtttagggcctgctgtcagaccaggtagtgctgtgtttaaa
gaaataagtgaactttcccctgctcacctagctattattaataagaaagatatcgtcatt
aaagaatactggcagctaagggctactgaaaatcacgaaacgttgtcggaagctaccgaa
catttacaacatttacttattgatgccattgaacgccaattagtcggtgatgtaccttta
tgtacttttctgtcaggtggcttagattcctctgctatttctgctattgctgctcgttct
tatcaaaagcgcaataaagtacttaccacctattctcttgactacgaagataatgataaa
tactttaaagcctctatctatcagcctacttccgatcaatattgggcactgcaaatggct
gagtttatccaaagtaatcatcgtacttatacgatcaaacacgatgagctagcttatgct
ttaaagtctgctgttctagctcgtgatttgcctggtatggcagatatcgactcttctctc
ttcttattctgcaaagaaattcgagaagattttatagttgctttatctggtgaatgtgcc
gacgaagttttcggtggctatccttggtatactaggcctgaacttaggaacctagaaacc
tttccttggtccaattttgttcgaagccgcaaacagctcctttctcctgaatacgcctct
cttcctcttgaagaaatagtccaggagaattatttagatagtttaaaacttgtccctcaa
ttaggttatgaatctcttgaaagacaacgtacaagagaaattttctatttaaatatgaaa
tggttcatggttaatctcttaaaccgtaaagaccgtatgagtatggctaatagcttagaa
gtacgtgtaccttttgccgattaccgtttagtcgaatacgcttttaatttgccagatgac
tacttattctatcaagggcgagaaaagggcctccttcgcaaggcacttaaaggcatttta
cctgaagatattatttatcgcaaaaagagtccttatcctaaaacacacaatcctatttat
acccagcttgtaagtaatatgcttagcgaagttttgcaaaataaaaatgcgccactcttt
actattattaataaagagtttgcgcagaaattagtagataccaaaggtgaagcttataca
aggccttggtttggtcagcttatgacagggccacaacttattgcttatcttgttcaactt
aatatatggcttgagagctacaaagtaaagttggtataa

DBGET integrated database retrieval system