KEGG   Cellulosilyticum lentocellum: Clole_3706Help
Entry
Clole_3706        CDS       T01448                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Clole_3706
Enzymes [BR:cle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Clole_3706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4055148..4057169)
Genome map
AA seq 673 aa AA seqDB search
MINDEKVKKILFGGDYNPEQWPEEILEEDMKLFKKAGVDVVTLNVFNWAMLQPSEEEYDF
SRLDKEMDYLKANNMKVCLATSTAAHPAWMAKKYPEILRTEFSGMRRKFGGRHNSCPNSL
VYKKYAVRLATKLAERYKHYDNIVAWHISNEFGGKCYCDTCEKAFRVWLQNRYKTLEALN
KAWNTSFWGHTFYAWDEIVVPNLQSEHFEWERSMFQGISLDYARFSSDSMLECYKEEYEA
IKRITPEIQITTNLMGFYKELDYHKWAKYMDFVSWDNYPSTDDPYYKMGMDHDLMRGLKD
GLPFALMEQTPSVTNWQPYNNLKRPGVMRLWSYQAVAHGSDTIMYFQMRRSIGACEKYHG
ALIDHVGTGETRVFKECEVLGAELEKLGDEIIGSVVKSKVAILFDWDNWWALEYSAGPSK
ELRYIKEVFKYYTALAKQNINIDIIGVDADLSPYQLVIAPVLYMIKGDYHKKLEEFVRAG
GQFITTFFSGIVDEHDLVTIGGYPGKLRELLGIWVEEIDALPPGEANKLVMTDGRIYSAE
LLCDLIHLETAEVVAVYGEDFYAGTPAVTVNHFGKGKAWYVGSSSSEEFFIDFLKECLEE
VEIKPIMTLSEGLEITRRYKAEIEYTFILNHNKEAKEITFDQEYVDLLRDITYKKGEVLN
LSAKDVLLLKAND
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgatgagaaggtaaagaaaattttatttggtggcgactataatccagagcaa
tggccagaggaaatcttagaagaagatatgaaactttttaaaaaagctggggtagatgtt
gtaactctcaatgtatttaactgggctatgcttcagccaagtgaagaagaatatgacttt
tcaaggttagataaggaaatggactacttaaaagcaaacaatatgaaagtttgtctagct
acttctacagcagctcacccagcttggatggctaaaaagtatccggagattcttcgcaca
gagtttagtggcatgaggaggaagtttggtggacgccataattcttgtcctaatagttta
gtttataaaaaatatgcagtacgtttagcaaccaagctagcagaacgttataaacactat
gacaatatcgtagcgtggcatatttcaaatgagtttggtggtaaatgctattgtgatacg
tgtgaaaaagcctttagagtatggttgcaaaatagatataagactttagaagctttaaat
aaagcatggaatacaagcttttggggacataccttttatgcttgggatgaaatcgttgtt
cctaatcttcaaagtgagcactttgaatgggaaagaagtatgttccagggtatttctctg
gattatgcacgttttagttcagacagtatgttagagtgctacaaagaagagtatgaagct
atcaaacgtataacaccagagattcaaataacgactaatcttatgggcttttataaagaa
ttagattatcataaatgggctaaatatatggattttgtttcttgggataactatccttct
actgatgatccttattataagatggggatggaccatgatttaatgagaggacttaaggat
ggcttgccttttgctttaatggagcaaacacctagtgtaacgaattggcagccttataat
aacttaaaaaggcctggagtaatgcgcctttggagttatcaagctgtagcacatggttct
gatacgattatgtacttccaaatgagaaggtctattggtgcttgtgagaaatatcacggg
gcactgattgatcatgtgggaacaggagaaaccagggtatttaaagaatgtgaagttcta
ggagcagagcttgaaaagctaggagatgaaattattggctctgtggtgaagtctaaggta
gctattttatttgactgggataactggtgggcactagaatattcagcaggtccaagtaaa
gaacttcgttatatcaaagaagtatttaaatattatacagccttagctaaacaaaatatt
aatatagatattatcggtgtagatgcagacctgtccccataccaattagttatagctcca
gtactttatatgataaaaggtgattatcataagaaactagaagagttcgtaagagcaggt
ggtcagtttataacaaccttctttagtggtattgtagatgaacatgatttagtaactata
ggtggttacccaggaaaattaagagaacttctaggtatatgggtagaggagattgatgcc
ttaccaccaggggaagcaaataaacttgttatgacagatggacgtatatatagtgctgag
ctactatgtgacttgatccacttagaaacggcggaagtagtagcagtctatggtgaagat
ttctatgcaggaacacctgctgttacagtcaatcattttgggaaaggtaaagcttggtat
gttggcagtagctctagcgaagaattcttcatcgatttccttaaagaatgtctagaagaa
gtagaaattaaacctattatgactttatctgaaggtttggaaattacaagacgctataaa
gcggagatagaatataccttcattcttaatcataataaggaagctaaggaaattacattt
gatcaagagtatgtagatttactaagggatattacctacaaaaaaggagaagttttaaac
ttaagtgcaaaagatgttttattattaaaagcaaatgattga

DBGET integrated database retrieval system