KEGG   Clostridium lentocellum: Clole_3827Help
Entry
Clole_3827        CDS       T01448                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cle  Clostridium lentocellum
Pathway
cle00040  Pentose and glucuronate interconversions
cle00052  Galactose metabolism
cle00500  Starch and sucrose metabolism
cle00520  Amino sugar and nucleotide sugar metabolism
cle01100  Metabolic pathways
cle01130  Biosynthesis of antibiotics
Module
cle_M00362  Nucleotide sugar biosynthesis, prokaryotes
cle_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clole_3827
   00052 Galactose metabolism
    Clole_3827
   00500 Starch and sucrose metabolism
    Clole_3827
   00520 Amino sugar and nucleotide sugar metabolism
    Clole_3827
Enzymes [BR:cle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Clole_3827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADZ85507
UniProt: F2JIN7
Position
complement(4197098..4197970)
Genome map
AA seq 290 aa AA seqDB search
MSKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVASGIEDIIIVTGRT
KKAIEDHFDKSVELEMELEKKQSKKLLEIARSVSQIANIYYIRQKEPKGLGHAVLTAKTF
VGNEPFAVLLGDDVIDSEKPALKQMIEVYEKYNASVLGVQTVERKDVNKYGIVDGVQLDS
RIYEVKNMVEKPPIDEAPTNVAVLGRYIITPRIFDYLEKQEIGAGGEIQLTDALNKLAKE
EPMYAYDFIGHRYDVGNKMGFLQATVEFALKRPELNEEFKAYLKEIVKTF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataagaaaagcaatcatacctgcagcgggattagggacaaggtttttacct
gctactaaagcacagccaaaagaaatgttaccaatagtagacaaaccaacaattcaatat
atagtagaggaagctgttgcatcaggaatagaagatattattatcgtaacaggaagaact
aaaaaagcaatagaagaccattttgataaatcagtagaattggaaatggaactagagaag
aaacaaagtaaaaagcttttagaaattgcaaggtcagtgtctcaaatagctaacatttat
tatatacgacaaaaagaaccaaagggcttaggtcatgcagtcctaacagctaaaactttt
gtgggaaatgagccatttgcagtactacttggtgatgatgtcattgattcggagaagcca
gcgcttaagcaaatgatagaagtatatgaaaaatataatgcatctgttttgggtgtccaa
acagtagaaagaaaagacgttaataaatatggaatagtagatggagttcaattagatagt
cgtatttatgaagtaaaaaatatggtggaaaaaccacctatagatgaagcaccaaccaat
gtagcagtactaggaagatacattattactcctagaatatttgattaccttgagaaacag
gaaataggagcaggtggagaaatccaacttacagatgcacttaataaattggctaaagaa
gagccgatgtatgcatatgattttattggacatcgctatgatgtaggtaataaaatggga
ttcctccaagcaactgttgaatttgcgttaaaaagaccagaactaaatgaagaatttaaa
gcatatctaaaagaaattgtaaaaacattttaa

DBGET integrated database retrieval system