KEGG   Cellulosilyticum lentocellum: Clole_3827Help
Entry
Clole_3827        CDS       T01448                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clole_3827
   00052 Galactose metabolism
    Clole_3827
   00500 Starch and sucrose metabolism
    Clole_3827
   00520 Amino sugar and nucleotide sugar metabolism
    Clole_3827
Enzymes [BR:cle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Clole_3827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4197098..4197970)
Genome map
AA seq 290 aa AA seqDB search
MSKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVASGIEDIIIVTGRT
KKAIEDHFDKSVELEMELEKKQSKKLLEIARSVSQIANIYYIRQKEPKGLGHAVLTAKTF
VGNEPFAVLLGDDVIDSEKPALKQMIEVYEKYNASVLGVQTVERKDVNKYGIVDGVQLDS
RIYEVKNMVEKPPIDEAPTNVAVLGRYIITPRIFDYLEKQEIGAGGEIQLTDALNKLAKE
EPMYAYDFIGHRYDVGNKMGFLQATVEFALKRPELNEEFKAYLKEIVKTF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataagaaaagcaatcatacctgcagcgggattagggacaaggtttttacct
gctactaaagcacagccaaaagaaatgttaccaatagtagacaaaccaacaattcaatat
atagtagaggaagctgttgcatcaggaatagaagatattattatcgtaacaggaagaact
aaaaaagcaatagaagaccattttgataaatcagtagaattggaaatggaactagagaag
aaacaaagtaaaaagcttttagaaattgcaaggtcagtgtctcaaatagctaacatttat
tatatacgacaaaaagaaccaaagggcttaggtcatgcagtcctaacagctaaaactttt
gtgggaaatgagccatttgcagtactacttggtgatgatgtcattgattcggagaagcca
gcgcttaagcaaatgatagaagtatatgaaaaatataatgcatctgttttgggtgtccaa
acagtagaaagaaaagacgttaataaatatggaatagtagatggagttcaattagatagt
cgtatttatgaagtaaaaaatatggtggaaaaaccacctatagatgaagcaccaaccaat
gtagcagtactaggaagatacattattactcctagaatatttgattaccttgagaaacag
gaaataggagcaggtggagaaatccaacttacagatgcacttaataaattggctaaagaa
gagccgatgtatgcatatgattttattggacatcgctatgatgtaggtaataaaatggga
ttcctccaagcaactgttgaatttgcgttaaaaagaccagaactaaatgaagaatttaaa
gcatatctaaaagaaattgtaaaaacattttaa

DBGET integrated database retrieval system