KEGG   Cellulosilyticum lentocellum: Clole_3838Help
Entry
Clole_3838        CDS       T01448                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clole_3838
Enzymes [BR:cle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Clole_3838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4209473..4210969)
Genome map
AA seq 498 aa AA seqDB search
MSRKSGIIMHISSLSEKYGIGSFGKKAYEFADFLKEAGQSYWQILPLGPTSYGDSPYQSF
SAFAGNPYFVDLETLEKEGLLKPEDYVDVDFGSDEFVDYEKLFTERNKVLHIAYKNSKGK
LTKQIEAFKKENASWLKDYAMYMAIKFKMELRSWQEWDEDIKLRKPEVMKAYEKELKDEI
EYWIFVQYEFYKQWEALKSYVNSLGIKIIGDIPIYVSADSSDAWANDKLFKLDENKNPIF
VAGCPPDAFSDDGQLWGNPIYDWDYLEETGYEWWIERLKASLKLYDVIRIDHFRGFESYW
QIPFGHKTAKKGKWVKGPGIKLFKAVKEKLGDIDVIAEDLGYMTDKVINFRDKTGYPGMK
VLQFAFDTREESDYLPHNYTRNCVVYTGTHDNDTVMGWIDTTGNPEDVKNAKHYLKLDIC
EGYHWGFIRGAWSSVADTAIAQMQDFLGLGNEARMNLPSTLGGNWQWRIKDGALTKELAK
RIYDLTKMYGRLEEDSNE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaaaaagcggtattataatgcatatatcttccctttcagaaaaatatggtatt
ggtagctttggtaaaaaggcatatgaatttgctgacttcttaaaagaagcaggacaaagt
tattggcagatactaccattaggacctacaagctatggagattctccttaccaatcattt
tcagcttttgcaggaaatccttactttgtagacttagagaccttagaaaaagaagggtta
ttaaaaccagaagattatgtagatgttgattttggaagtgacgaatttgtagattatgaa
aaattatttacagagagaaataaggtattacatatagcttataaaaattcaaaaggtaag
ctaacaaaacaaattgaagcgttcaagaaggaaaatgcatcttggcttaaagactatgca
atgtatatggctattaaatttaaaatggaacttcgtagttggcaagaatgggatgaggat
attaagctcagaaagccagaagttatgaaggcatatgaaaaagagcttaaagatgaaatt
gaatattggatttttgttcaatatgaattttataaacaatgggaagctcttaaaagctat
gtaaatagtttaggtattaaaattattggggatattcctatctatgtttcagcagatagc
tcagatgcttgggccaatgataaacttttcaaattagatgagaataaaaatccaattttt
gttgcaggttgtccaccagatgctttctctgatgatgggcaattatggggaaatccaatt
tatgattgggactaccttgaagaaacaggttatgagtggtggattgaaagacttaaagct
agtttaaaactttatgatgtaatccgtattgatcacttcagaggttttgagtcttactgg
caaattccatttggtcataaaacagctaaaaagggtaaatgggttaaaggacctggcatc
aagctctttaaagcagttaaagaaaaattaggagacatcgatgttatagcagaagatcta
ggttatatgacagataaagtgattaactttagagacaaaacaggttatccaggtatgaaa
gtgcttcaatttgcatttgataccagagaagaaagcgattatttaccacataactatact
agaaactgtgttgtatatacaggaactcatgataatgacacagttatgggatggattgat
acaactggtaaccctgaagatgttaagaatgcaaaacattacttgaagttagatatttgt
gaaggctatcattggggcttcattagaggtgcttggagtagtgtagcagatacagcaata
gctcaaatgcaagatttccttgggttaggtaatgaggcacgtatgaatttaccttcaaca
ttaggtggaaactggcagtggcgtataaaagacggcgcacttacaaaagaacttgctaag
agaatttatgacttaaccaaaatgtatggaagattagaggaggattcaaatgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system