KEGG   Cellulosilyticum lentocellum: Clole_3865Help
Entry
Clole_3865        CDS       T01448                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Clole_3865
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Clole_3865
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Clole_3865
Enzymes [BR:cle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Clole_3865
Exosome [BR:cle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clole_3865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4244230..4245753)
Genome map
AA seq 507 aa AA seqDB search
MKLSKKIFTAILCTALVGITAVGTIAVPARANTTNIVQSAKEQTYKKPKYIFNFIGDGMS
YVQVNSAQIYKGVTEKGGINLGKLAVSQFPVCGSATTQDSTSFAPDSASTATAISSGVKT
HSGVIGYNADKQTKPESITEKLKKEGYKIGIVSSVSIDHATPAAFYAHAVSRKDMYDIAL
QLADSNFDYFAGGSLVQPNGKNGDQKSAFEIIEEKGYNIVDTKEEILSLNSESGKVYAIN
PELQDSQAMSYDLDASKDSIRLKDFVEKGIDVLDNEDGFFMMVEGGKIDWAGHANDARSN
IQDVIALDEAIGVAVDFAKKHPEETLIIVTGDHETGGMTIGYSTTGYNTAFNLLANQDMS
YVAFDELLAEYKKGTTADKAKIEDVLPLIKKHFGLVSPSNAASAKDSALVLTEYEYNKLK
DAFAQTMKDSSERTNNQETGILYGGYEPLTVTLTHILNNKAGIGWTSYAHTGVPVPVYAM
GEGAELFSGAYDNTDIFNKLVALCELK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttcaaagaagatttttacagctattttatgtacagcccttgtaggcataaca
gcagtggggacaattgcagtgccagctagagctaatacgactaatattgtacagagtgct
aaagagcaaacttacaaaaaacctaaatacatatttaattttattggggatggtatgtct
tatgtacaagttaattctgcacaaatctataaaggtgtaactgaaaaaggtggtattaac
ttaggcaagctagcagtatcccagtttccagtatgtggatcagctacaacccaagactct
acatctttcgccccagattcagcttctacagcaacagctatttctagcggtgttaaaaca
catagtggtgtaattggttacaatgcagataagcaaaccaaaccagaaagtattacagaa
aagcttaaaaaagaaggatataaaatagggatagtaagtagtgtatctatagatcatgca
acaccagcagctttttatgcacatgcagtatctagaaaggatatgtatgatatcgcactc
cagttagcagatagtaattttgattattttgcgggtggttcattagtacagccaaatggt
aaaaatggtgatcaaaaaagcgcatttgaaattattgaagagaaaggatacaacattgta
gatacaaaggaagaaattctttcacttaatagtgagtcaggtaaagtatatgctattaat
ccagagcttcaagactcacaggctatgagctatgacttagatgctagtaaggatagtatt
agattaaaggattttgttgaaaaaggaattgatgttttagataatgaagatggtttcttc
atgatggtagaaggaggcaagattgactgggcaggtcatgctaatgatgccagatctaat
attcaagatgttattgcattagatgaagctattggggtagcagttgattttgctaaaaag
catccagaggaaacacttattattgtaacaggggatcatgaaacaggcggtatgactatt
ggatattctacaacaggctataatacggcatttaacctcttagctaatcaggatatgagt
tatgtagcttttgatgaattacttgcagagtacaaaaaagggactacagcagataaggcc
aaaatcgaagatgtacttcctcttattaaaaagcactttggtttggtgagcccaagtaat
gctgcatcagctaaggattcagcattagtattaactgagtatgaatataacaaattaaaa
gatgcctttgctcaaaccatgaaagatagcagtgagcgcactaataatcaagaaacaggc
attttatatggtggctatgagccacttactgtgacactcacacatatcttaaataataaa
gcaggtattggttggacctcttacgcacatacaggtgtacctgttccagtttatgcaatg
ggtgaaggtgctgaactctttagtggtgcttatgataatacagacattttcaataagtta
gttgctctttgtgaattaaaatag

DBGET integrated database retrieval system