KEGG   Clostridium lentocellum: Clole_3906Help
Entry
Clole_3906        CDS       T01448                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cle  Clostridium lentocellum
Pathway
cle00260  Glycine, serine and threonine metabolism
cle00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cle01100  Metabolic pathways
cle01110  Biosynthesis of secondary metabolites
cle01130  Biosynthesis of antibiotics
cle01230  Biosynthesis of amino acids
Module
cle_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clole_3906
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clole_3906
Enzymes [BR:cle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clole_3906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADZ85585
UniProt: F2JJJ0
Position
complement(4298681..4299859)
Genome map
AA seq 392 aa AA seqDB search
MLKDVFGSFGGAYVPEAQLKALKELEEVFLKYRDDEEFNAELNYYLKDYVGRQSPLYYAD
NLTKACGGAKIYLKREDLNHTGAHKINNVLGQVLLAKRMGKKKVIAETGAGQHGVATATV
AALMGMECTVYMGKEDMKRQALNVFRMEMLGAKVVAATSGTQTLKEAVDEAIDAWVNASD
DTFYVLGSAVGPHPYPTIVKHFQKVISEESRAQILEKEGKLPKAIIACVGGGSNAIGSFA
AYIEDSEVELIGVEAAGKGIDTPMHAATIAKGEPTVLHGMKTLCVLDENKEVAPVYSISP
GLDYPGIGPEHAYLNEIGRGKYVTITDAEAVEALLTLCKTEGILPAIESSHALAYAMKYA
PTCKPEEAIIVTVSGRGDKDVEAIADYLKENQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagatgtattcggaagttttggtggcgcttatgtgccagaagcacagcttaaa
gcacttaaagagttagaagaagttttcttaaagtatcgtgatgatgaagagtttaatgca
gaacttaattattacttaaaagactatgtaggtcgtcagtcaccactttattatgcagac
aacttaacgaaagcttgtgggggcgctaaaatttatttaaaaagagaagaccttaatcat
acaggagctcacaagattaacaacgtactagggcaagtattacttgcaaaacgtatgggt
aaaaagaaggtaattgctgaaacaggagctggtcaacatggtgttgcaacagcaacagta
gcagcacttatgggtatggaatgcactgtttatatgggcaaagaagatatgaaaaggcaa
gcacttaatgtatttcgtatggaaatgctaggggcaaaggtagtagcagctacttcaggt
actcagaccttaaaagaagccgttgatgaagctattgatgcatgggtaaatgcttctgat
gataccttttatgtacttggctcagcagtaggaccacatccttacccaactattgtaaag
cacttccaaaaagtcattagtgaagaatctagggcacaaattctagaaaaagaagggaag
ctccctaaagcaattattgcttgtgtaggtggtggtagcaatgctataggttcttttgcg
gcctatatagaggattcagaagttgagctaattggcgtagaagcagcaggtaaaggaatt
gatacccctatgcatgcagctactatagctaagggtgagccaacagtattacatgggatg
aagacgctttgtgtattagatgaaaacaaagaagttgcgcctgtttattctatttcacca
gggcttgattacccaggaataggaccagaacatgcttatctaaatgagataggtagaggc
aaatatgtcactattacagatgctgaagctgttgaagcacttctaaccctttgtaaaaca
gaaggtattttgccagcgattgagagttctcatgcattagcttatgctatgaaatatgca
cctacctgtaagccagaggaagccattattgttacggtttcaggccgtggagataaagat
gttgaggcaatagccgattatttaaaagaaaatcaatag

DBGET integrated database retrieval system