KEGG   Cellulosilyticum lentocellum: Clole_3922Help
Entry
Clole_3922        CDS       T01448                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clole_3922
Enzymes [BR:cle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Clole_3922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4317366..4318823)
Genome map
AA seq 485 aa AA seqDB search
MVASPFGKEGQKMSGLRKDFLWGGATAANQCEGGYLSGGKGLGTVDVIPHGEYRKAIMKG
EMHYKDLPEDAYYPSHEAIDMYGNYKEDIALFAEMGFKCYRFSFAWSRIFPTGKELEPNE
EGLKFYEDFIDELLKYNIEPVVTICHFDLPLTLVEEYGSWRSRQVIDAYVRYCEAIFKRF
NGKVKYWMTFNEINMLMHLPFMGAGIMFEEGDNKLQVQYQAAHNELVASALATKLAHDIN
PENKVGCMLAAGDYYPYSCKPEDVFAALGKDRENYFFIDVQSRGEYPNYAKKFLEHNNIQ
IEMGQEDEKILRENTVDFIAFSYYSSRVVSADPTVGEPKLGNAFAGIKNPHLPESEWGWQ
IDPLGLRITMNTLYDRYQKPLFIVENGLGAVDTLKEDGTVDDDYRIAYLEAHIKAMIEAV
EEDGVDLLGYTPWGCIDLVSASTGEMKKRYGFIYVDKDNAGNGDLKRYKKKSFYWYKKII
ENNGL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
ttggtagcatccccttttgggaaagagggacagaagatgagtggacttagaaaagatttt
ttatggggcggcgcaacagctgctaatcaatgtgaaggtggttatttatcaggaggcaaa
ggccttggaacagtagatgtcattcctcatggagaatatagaaaagctattatgaagggt
gaaatgcactataaagatttgccagaggatgcatactacccttctcatgaagccattgat
atgtatggcaactataaagaagatattgctttatttgcagaaatgggctttaaatgctat
cgtttttcttttgcgtggtcacgtatctttccaactggtaaagaattagagccaaatgaa
gagggacttaaattctatgaagatttcattgatgaattattaaaatacaatattgaacca
gttgttacaatttgtcactttgatttaccacttacacttgtagaagagtatggttcatgg
agaagtcgtcaagtaatcgatgcttatgtaagatattgtgaagcgattttcaaaaggttt
aatggtaaagttaaatactggatgacatttaacgaaatcaatatgctcatgcacttacca
tttatgggggcagggattatgttcgaagaaggagacaacaaacttcaagtacaataccaa
gcagctcataatgaactagtagcatcagctttagcaactaagcttgctcacgacattaat
ccagaaaacaaagtaggttgtatgcttgcagcaggagattactatccatatagctgtaaa
ccagaagatgtatttgcagcattaggtaaagatagagaaaattacttctttattgatgtt
caatcaagaggagaatatccaaactatgctaagaaattcttagaacataacaatattcaa
attgagatgggtcaagaagatgaaaagatcttaagagaaaacacagtagatttcattgca
tttagttattattcatcaagagtagtgagtgcagatccaacagtaggtgagccaaagtta
gggaatgcctttgctggtatcaaaaacccacacttacctgaaagtgaatggggatggcaa
attgacccacttggtcttagaattacaatgaatactttatatgaccgttatcaaaaacca
cttttcatcgtagaaaatggtttaggtgcagtagatactttaaaagaagatggcacagta
gatgatgattacagaattgcttatttagaagcacacattaaggcaatgattgaagcagta
gaagaagatggtgtagacttattaggttatacaccttggggatgtatcgatcttgtaagt
gcctcaacaggtgagatgaaaaaacgctatggttttatttacgtagataaagataatgct
ggtaatggagacttaaaaagatataaaaagaaatccttctattggtataaaaaaattatt
gagaataatggactatga

DBGET integrated database retrieval system