KEGG   Cellulosilyticum lentocellum: Clole_3976Help
Entry
Clole_3976        CDS       T01448                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cle  Cellulosilyticum lentocellum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clole_3976
Enzymes [BR:cle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Clole_3976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4376859..4378016
Genome map
AA seq 385 aa AA seqDB search
MLKDFKKYLFVLLILCPFMVSCSMSTNNEMASTPSSSTPSTVLETVEPTTKDASNSPTPV
STPSISLPEPKPAPTFDPSTPVGMHGRLNVKETYIVDENQEPFQLRGVSTHGIQWFPAFV
NEGCFNTLRDDWKANVIRLAMYTDNNSGYLGNTEGLENLMREGIDLATKAGLYVIVDWHC
LSDGNPNTHKDEAIRFFSEISAEYQNYPNIIYELCNEPNGADVTWDNEVKPYCETLISTI
RAIDKQGIIIAGTPTWSQDIHLAAQNPLEGENIMYALHFYADTHRDSLRQRLVDCINKYK
LPVFVSEFGTCDASGNTGFNEEQSDIWMDLLNEHNVSWVNWSLCDKKETASLLKPLTISR
GNWTDDDLSESGLFIKNRLLEAASH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaggattttaaaaaatatctttttgtattacttatactttgcccatttatggtc
agctgttcaatgtctacaaataatgaaatggcttctacgccttctagttcaactccctca
actgtattagagacagtcgaaccaaccactaaagatgcgtccaattctcctaccccagta
tccactcctagcatctctcttcccgaacccaaacctgctcctacctttgaccctagtacc
cctgtaggtatgcatggaagacttaatgtgaaggaaacttacatagtagatgaaaatcaa
gaaccttttcagcttcgtggtgtcagcactcatggcatacaatggtttccggcttttgta
aatgagggttgttttaatacgctacgtgatgactggaaggcaaatgttattcgtctggca
atgtatacggacaataattctggctacttaggaaatactgagggcttagaaaacttaatg
cgagaaggcattgatcttgctactaaagctggtctctatgttattgtagactggcactgc
ttaagcgatggcaatcctaatacacataaagatgaagctattagattctttagtgagata
tcagctgaatatcaaaactatcctaatattatttatgaactgtgtaatgagccaaatggt
gcagatgtaacctgggacaatgaagttaaaccttactgtgagacacttatttcaactatt
cgtgccattgataagcaaggtattatcatagctggtacacctacttggagccaagatatc
catttagctgcccaaaatccattggagggtgaaaatattatgtatgcactccacttctat
gctgatacacaccgtgactcattacgtcagcgcttagtggattgtattaataaatataag
ttacctgtattcgtatctgaatttggtacttgtgatgcctctggtaatactggcttcaat
gaagagcaatctgatatctggatggacctactcaatgaacataatgtaagctgggtaaac
tggagtctttgtgataaaaaagaaactgcctctcttttaaaaccacttacgatttcaaga
ggaaattggactgatgacgatttatctgaatctggattgtttattaaaaatagactttta
gaagcagctagtcattag

DBGET integrated database retrieval system