KEGG   Clostridium lentocellum: Clole_4160Help
Entry
Clole_4160        CDS       T01448                                 

Definition
(GenBank) Pyruvate synthase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
cle  Clostridium lentocellum
Pathway
cle00010  Glycolysis / Gluconeogenesis
cle00020  Citrate cycle (TCA cycle)
cle00620  Pyruvate metabolism
cle00640  Propanoate metabolism
cle00650  Butanoate metabolism
cle00680  Methane metabolism
cle01100  Metabolic pathways
cle01120  Microbial metabolism in diverse environments
cle01130  Biosynthesis of antibiotics
cle01200  Carbon metabolism
Module
cle_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clole_4160
   00020 Citrate cycle (TCA cycle)
    Clole_4160
   00620 Pyruvate metabolism
    Clole_4160
   00640 Propanoate metabolism
    Clole_4160
   00650 Butanoate metabolism
    Clole_4160
  Energy metabolism
   00680 Methane metabolism
    Clole_4160
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clole_4160
Enzymes [BR:cle01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clole_4160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C Protoglobin
Motif
Other DBs
NCBI-ProteinID: ADZ85832
UniProt: F2JMR7
Position
complement(4583719..4585047)
Genome map
AA seq 442 aa AA seqDB search
MIETNIKEKGTQDQFISGDEAVAIGVKLAKPDVIAAYPITPQTIVVERLAEMVETGELEA
EYMYVESEHSALAAVMGASVMGVRTFTATSSQGLLYMAEVLHYASGGRVPLVMMNANRSV
ALPWSIFGDQRDSLSLLDSGWIQVYVENAQESLDMILQAYALAEHPEVLTPVMVNLDGFI
LTHTYEKVEVPSEKQVKAFLPVFKLEGQMDLKAPKNLFFTSSPAHNMAFKYQQHEAMLKA
KNIIKNIDDQYSKITGRSYCGLVEDYKCQDAEVIVITLGSVTGLVRDVVDELREKGQKVG
VLKIRYMRPFPEEEIVKYTASAKAIAVLEKDISFGYQGTVFTNVVAALHERKAKLYNYIA
GLGGKDIKEAEIRDIYAQLYAKLLEHKKTAQIIAEHADTTGTYRSASVSLVEDSEADRLA
NFETKRLSSDENQVIFVGLEGK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaactaacataaaagaaaaaggaacacaagatcaatttatatcaggggatgaa
gcagtggctattggcgtaaaactagcaaagccagatgtcatagcagcttatcccattacg
cctcagaccattgtagtagaacgtcttgccgaaatggtagaaacaggtgaactagaagcg
gaatatatgtatgttgaatctgaacactctgcccttgctgctgttatgggagctagtgtg
atgggtgtaaggacgtttacagcaacctcatctcaaggcttattatatatggctgaagtt
ttacattatgccagtggtggaagagtacctttagtaatgatgaatgccaatagaagcgtg
gctttgccatggagtatatttggggatcaaagagattctttatctttacttgatagtgga
tggattcaagtttatgtggaaaatgctcaagagagcctagatatgatactgcaagcttat
gccttagcagagcatccagaggttcttacacctgttatggttaacttagatggctttatc
cttacccatacctatgaaaaagtagaagtaccaagtgagaagcaagttaaggcattttta
ccagtttttaagctagaaggacaaatggacttaaaggcacctaaaaatctattttttact
tcctctccagcgcataatatggcattcaaataccaacaacatgaagcaatgctgaaggca
aaaaacattataaaaaatatagatgatcagtatagcaaaatcacaggaaggtcttattgc
ggattagtagaagactataagtgccaagatgctgaggttattgttatcacattaggtagt
gtgacagggcttgttagagatgtggtagatgaactacgtgaaaaaggacagaaggtaggg
gttcttaaaataagatatatgaggcctttcccagaagaagaaattgttaaatatacagct
tctgctaaagctattgctgtattagaaaaagacatatcctttggctatcaaggaaccgta
tttactaatgtagtagcagcgctgcatgaaagaaaggcaaagctttataactatattgcc
ggccttggaggaaaggatattaaagaagctgaaataagagatatttatgcccagctttat
gctaaacttttggaacataaaaaaacagctcagattattgcggagcatgcagataccaca
ggaacttatcgtagtgcaagtgtgagtctagtagaagatagtgaagctgatagactggct
aatttcgagacgaagaggctaagttcagatgaaaaccaagtgatttttgttggattggag
gggaaataa

DBGET integrated database retrieval system