KEGG   Clostridium lentocellum: Clole_4161Help
Entry
Clole_4161        CDS       T01448                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
cle  Clostridium lentocellum
Pathway
cle00010  Glycolysis / Gluconeogenesis
cle00020  Citrate cycle (TCA cycle)
cle00620  Pyruvate metabolism
cle00640  Propanoate metabolism
cle00650  Butanoate metabolism
cle00680  Methane metabolism
cle01100  Metabolic pathways
cle01120  Microbial metabolism in diverse environments
cle01130  Biosynthesis of antibiotics
cle01200  Carbon metabolism
Module
cle_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clole_4161
   00020 Citrate cycle (TCA cycle)
    Clole_4161
   00620 Pyruvate metabolism
    Clole_4161
   00640 Propanoate metabolism
    Clole_4161
   00650 Butanoate metabolism
    Clole_4161
  Energy metabolism
   00680 Methane metabolism
    Clole_4161
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clole_4161
Enzymes [BR:cle01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clole_4161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_7 Fer4_2 Fer4_10 Fer4_21 Fer4_9 Fer4_16 Fer4_17 Fer4_18 Fer4_15 Fer4_13 Fer4_4 Fer4_22 Fer4_8
Motif
Other DBs
NCBI-ProteinID: ADZ85833
UniProt: F2JMR8
Position
complement(4585034..4585351)
Genome map
AA seq 105 aa AA seqDB search
MARPIVNKDFQIKGLQGLPCGTYGSAMLLTETMEGWRSQHPVIEHDKCIHCNWCYMVCPE
GVIYENDNKIQIDYRFCKGCGICQKECKKQCIIMEEEGGVEDDRN
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctagaccaatagtaaacaaagattttcagataaaaggcttacaaggtttgccttgt
ggtacttatgggtcagctatgctactcactgagactatggaagggtggagaagtcagcat
ccagtcattgaacatgataagtgcatccattgtaattggtgttatatggtttgtcctgaa
ggtgttatttatgaaaatgataacaaaatacaaatcgattatcgtttttgcaaaggctgt
ggtatctgccaaaaagaatgtaagaaacagtgcattatcatggaggaggaagggggagta
gaagatgatagaaactaa

DBGET integrated database retrieval system