KEGG   Caldisphaera lagunensis: Calag_0032Help
Entry
Calag_0032        CDS       T02380                                 

Definition
(GenBank) phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
clg  Caldisphaera lagunensis
Pathway
clg00010  Glycolysis / Gluconeogenesis
clg00030  Pentose phosphate pathway
clg00051  Fructose and mannose metabolism
clg00052  Galactose metabolism
clg00230  Purine metabolism
clg00500  Starch and sucrose metabolism
clg00520  Amino sugar and nucleotide sugar metabolism
clg00521  Streptomycin biosynthesis
clg01100  Metabolic pathways
clg01110  Biosynthesis of secondary metabolites
clg01120  Microbial metabolism in diverse environments
clg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calag_0032
   00030 Pentose phosphate pathway
    Calag_0032
   00051 Fructose and mannose metabolism
    Calag_0032
   00052 Galactose metabolism
    Calag_0032
   00500 Starch and sucrose metabolism
    Calag_0032
   00520 Amino sugar and nucleotide sugar metabolism
    Calag_0032
  Nucleotide metabolism
   00230 Purine metabolism
    Calag_0032
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calag_0032
Enzymes [BR:clg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Calag_0032
    5.4.2.8  phosphomannomutase
     Calag_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFZ69825
UniProt: L0A9U3
Position
complement(24681..26051)
Genome map
AA seq 456 aa AA seqDB search
MARLFGTDGVRGIVGELITPEFSLRMGHAIGAYFGKGSRLLIGRDVRLGGDMVVRSLTAG
LLAEGIKVYDAGLLPTPALQYGIKSLGFDGGVMITASHNPPEYNGIKVISSDGIEIPHEN
EDIIENYYFNNYLSKMEWRSYDNFVKSRDDIIDIYIDAIINQVDVEKIAKKNFKVVVDCA
NSVGSLTSPLLLRKLGVKAFTVNCNLDPYFPGRNPEPNAETLQNTLNYIKLIKADAGFAH
DGDADRAMVLDNEGRIQWGDRTGALLTEFSSKIWKNYNKKTYTAVSSSILVEEYLKPKGI
DVAWTPVGSVTIAREITKNNDAISGFEDNGGYLHVPHHVVRDGAMTIALTLYMLSETNET
LNNIYNKLPQYYAIKAKIEANREQALCGVEAVKEKYSSYRMITIDGVKVFGDDFWLLVRP
SGTEPILRITGEAKDKEKIEKIINDTIKYVKERCIR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
ttggccaggctttttggaacagatggagtaagaggtattgtaggagagctaataacgcca
gaattttcattaaggatgggccatgcaataggagcatactttggaaaaggttctagatta
cttattggaagggatgtaaggttaggtggggatatggttgttagatcattaactgcaggc
ctacttgctgagggaatcaaagtttacgatgcaggcctacttccaacaccagctttacaa
tatggaataaagtctttgggttttgatggtggagttatgattaccgcaagccataatcca
cctgaatataatggaattaaagttatatcaagcgatgggatagaaataccccatgagaat
gaagatattatagaaaactattattttaacaattatttgtcaaaaatggaatggagatct
tatgataattttgtaaagagtagggatgatataattgatatttacatagatgctataatt
aaccaggttgatgtagaaaaaattgctaagaaaaactttaaagttgttgttgattgtgct
aatagtgttggatctttaacttctccattattattaagaaaattaggtgtaaaagccttt
acagtaaattgtaacttagatccatattttccaggaaggaatcctgaaccaaatgcagaa
acattgcagaacacattaaattatataaaattaattaaagcagatgcaggttttgctcat
gatggagatgctgatagagcgatggtattagataatgagggaagaatacaatggggagat
agaacgggcgcattgttaacagaattttcatctaaaatatggaaaaattataataagaaa
acgtatacagctgtttcgagcagtatacttgtagaagaatatctaaaacctaagggaatt
gatgtagcttggacgcctgttgggagtgttaccatagctagggaaataactaaaaacaat
gatgccattagtggtttcgaagataatgggggttatttgcacgtaccccatcatgtggta
agggatggagctatgacaattgcattaactctatacatgctctctgaaactaatgaaaca
ttaaataatatttataataagcttccacaatattatgcaattaaagcaaaaatagaagct
aatagagaacaggccttatgtggtgtagaagcagttaaagaaaaatactcatcttataga
atgattacgattgatggggtaaaggtttttggagatgatttttggttacttgttagacca
agtggtactgaacccatattgaggataactggagaagcaaaagataaagaaaaaattgaa
aaaattatcaacgatacaataaaatatgttaaagagagatgtataaggtga

DBGET integrated database retrieval system