KEGG   Caldisphaera lagunensis: Calag_0076Help
Entry
Calag_0076        CDS       T02380                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
clg  Caldisphaera lagunensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Calag_0076
Enzymes [BR:clg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Calag_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(71009..71923)
Genome map
AA seq 304 aa AA seqDB search
MNYLEEPSNSFIRDEKDKKIKDFEKSIPLIGIPWDWSTAGKPGARFAPQSIRNELYSLRT
DVYELNEIKFGFNDLGNVRISPGDLNETSRRIISVCDDVFKKIKEKNPVIFLGGDHSITK
SILLSLSKFYNKIGLIIFDAHYDLREVKEGLTSGSWLNELLKDNKEKFNVIEIGISNYSN
PSYMKEIAKKYGIKVFYRDQIIDDLKDVFYEINKVKENTDGIYISIDMDHLDQSFAPGVN
SPTALGMYPHETIKIINEITRNSKILGIDTTEVSPPYDINNNTSRLAAKLLLYSINSYLG
NKNG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaattacctcgaagaaccaagtaatagctttattagagatgaaaaagataaaaaaatc
aaagattttgaaaagtctattcctttaataggaattccatgggattggtcaacagcagga
aagcctggagcaaggtttgctccgcaatctattagaaatgaattatatagtctaagaact
gatgtctatgaattaaatgaaattaaattcggatttaacgatttaggtaacgtaaggatt
tctccaggagatttaaatgaaacttcgagaagaattattagtgtttgcgatgatgttttc
aaaaaaattaaggaaaaaaatccagttatatttttaggtggtgatcattcgataacaaaa
agtatattattaagcctatcaaaattttataataaaataggattaattatatttgatgca
cattatgatttaagggaggtaaaggaaggattaacaagtggatcatggttaaatgaatta
ttaaaagataataaagaaaaatttaatgttattgaaataggaatatcaaattattctaat
cccagctatatgaaagaaatcgctaaaaaatatggaataaaagtattttatagagatcaa
ataattgatgatcttaaagatgtattttatgaaataaataaagttaaagaaaatactgat
ggaatttacataagcattgatatggatcacttagatcaatcatttgctccaggagttaat
agcccaacagcattaggtatgtacccacatgagactattaaaataataaatgaaataaca
aggaattctaaaattttaggtattgatacaactgaagtttctccaccatatgatattaat
aataatactagcagattagcagctaaattactcttgtattcaataaatagctatttgggg
aacaaaaatggttaa

DBGET integrated database retrieval system