KEGG   Caldisphaera lagunensis: Calag_0099Help
Entry
Calag_0099        CDS       T02380                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
clg  Caldisphaera lagunensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calag_0099
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calag_0099
Enzymes [BR:clg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Calag_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(94987..95715)
Genome map
AA seq 242 aa AA seqDB search
MNWLEEVIENSKNRIKVKNERKKKINSLKESLINLQQKGVTPIIAEYKRKSPSGFISDKD
YHNYINFLENYVAGFSVLTEEKYFGGSYEILESISEITNKPILMKDFIVTKDQIDNAFRI
GADAILLIASILNEDLLDQLINYARSYRLETLVEIHTYEEFEKIKSFKFDLLGINSRNLF
TLNVSLDNTIKLLRNIKGDYIKIAESGIKSKEDILKLKDNGANGFLIGTTLMKNPLIIRE
LL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaattggctagaagaagtaattgaaaattcaaagaatagaataaaagttaaaaatgaa
aggaagaagaaaataaattctttgaaagaatcgcttataaatttacaacaaaaaggggta
acaccaataatagctgaatataaaagaaaatctccttcgggatttatttctgataaagat
tatcataattacataaattttttagaaaattacgttgcaggctttagtgttttaacggaa
gaaaaatattttggaggctcttatgaaattttggaatctatttcagagattacaaacaag
cccatattaatgaaggattttattgtaacaaaagaccaaatagataatgcttttagaatt
ggggctgatgcaattttattaattgcttcgattttaaatgaagatctattagatcaatta
attaactatgcaagatcttatagactagaaacattagttgaaatacatacatatgaagaa
tttgaaaaaataaagagctttaagtttgatctattgggaataaattctagaaacttattt
accttaaatgtcagtttagataatacaataaagttgctgagaaacataaagggagattat
ataaaaatagcagaaagtggaattaaaagtaaagaagatattttgaaattaaaagacaat
ggagctaatggatttttaattggaactactttaatgaaaaatcctcttattataagagaa
ttattatga

DBGET integrated database retrieval system