KEGG   Caldisphaera lagunensis: Calag_0182Help
Entry
Calag_0182        CDS       T02380                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
clg  Caldisphaera lagunensis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:clg01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:clg00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(193275..194513)
Genome map
AA seq 412 aa AA seqDB search
MDIDEAIDEIKKDMINFLIKIINIPTENPPGLNYEKFVDYMYDFLISLDYNIKIVEPKEE
LKELVKYGSGRRPNIIANYGNKGVKIGFNSHYDVVPAGKGWSHDPYNATIEEGKIYGRGS
SDMKSGIASQIFAVEALKIMNNIKDKITIRQFIVPDEETVGNKNAGTYYLVEKGFINKEN
LNYLIFTEPLNPTNIGIGHRGALWGTFNLYGKKSHGGFPQKGLDVIRCASKIINYIYEIA
DKRSKTISKYPIIPEEAKRPSYLVGTINGGEWMNTVADFLTFSYVRRLIPEETLEFARNE
VNEIIKYTENECKGIKIEFLPYYEVDNIMFPVDNGVKIISEKIKEVYNVNPSIVLSPGTF
DIRFIYNKGIESFNYGPGLLELAHATDEYVYVEDLIKSTKVISLFLKEFLNK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggatatagatgaggcaatagacgagataaagaaagacatgataaattttttaataaaa
attattaatatacctacagaaaatcctccaggattgaattatgaaaaatttgttgattat
atgtatgattttttaatatctttagattataatataaaaattgttgagcctaaagaagaa
ttaaaagaattagttaaatatggtagcggaagaagaccaaatataattgcaaattatgga
aataaaggtgttaaaataggatttaattcccactatgatgttgttcctgctggaaaaggg
tggtctcacgatccatataatgctactatagaagaaggtaagatttatggaagaggatca
tcagatatgaaatctggtattgcatctcaaatttttgcagtagaagcattaaaaattatg
aataatataaaagataaaattacgataagacaatttattgtaccagatgaagaaactgtt
ggaaacaaaaatgcagggacttattatttagtagaaaaaggttttattaataaagaaaat
ttaaattatttaattttcactgagccattaaatccaactaatattggaataggtcacaga
ggtgcattatggggaacatttaatttatatggtaaaaaatctcatggtggttttccacaa
aaaggattagatgttataagatgtgcttcaaaaataattaattacatttatgaaattgca
gataaaagatcgaaaaccatttctaaatatccaataattcctgaagaggcaaaaagacca
tcttatttagtgggaacaataaatggtggagaatggatgaacacagttgctgatttccta
acattttcttatgtaagaagattaatacctgaagagaccttggaatttgctagaaatgaa
gtaaatgaaataataaaatatactgaaaatgaatgtaaggggattaaaattgaattttta
ccttattatgaggtagataatataatgtttcctgttgataatggagttaagattatttca
gaaaagattaaagaagtttataatgtaaatccatcaattgttttatctccaggcacattt
gatataaggtttatatataataaaggaatcgaatcgtttaattatgggccaggtttatta
gaattagctcatgcaacagatgaatatgtttatgttgaggatttaataaaatcaacaaaa
gtaatatcattgtttttaaaagaatttttaaataaatga

DBGET integrated database retrieval system