KEGG   Caldisphaera lagunensis: Calag_0308Help
Entry
Calag_0308        CDS       T02380                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
clg  Caldisphaera lagunensis
Pathway
clg00010  Glycolysis / Gluconeogenesis
clg00020  Citrate cycle (TCA cycle)
clg00620  Pyruvate metabolism
clg01100  Metabolic pathways
clg01110  Biosynthesis of secondary metabolites
clg01120  Microbial metabolism in diverse environments
clg01130  Biosynthesis of antibiotics
clg01200  Carbon metabolism
Module
clg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calag_0308
   00020 Citrate cycle (TCA cycle)
    Calag_0308
   00620 Pyruvate metabolism
    Calag_0308
Enzymes [BR:clg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Calag_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh AATase Transferase BROMI
Motif
Other DBs
NCBI-ProteinID: AFZ70087
UniProt: L0AAG0
Position
328382..329095
Genome map
AA seq 237 aa AA seqDB search
MEKNNSLPIKEIIEFDPIRQTIAERMMSSLQNSAQLTLMREAKVNGLVKFRESLQDSEYK
PTYTEILVKIVAKLLTNEENKLLNSFIEDNKIKVVSTVNLGVAVATNYGLVVPVIKNANN
KDLVQIVKELRELSNKAKNMQLTLEDIEGGTFTLTNLGMFGIDSFTPIINPPQTGILGVG
RIYKRPEFDENNNVIPSYLTWLSLTFDHRVLDGASAAIFLKELSEILDDDKKIQAIV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaataacagcctacctattaaagaaataatagaatttgatccaataaggcaa
actatagcagaaagaatgatgagtagcctacaaaactcagcacaattaactcttatgaga
gaagcaaaggtaaatggtttggttaaatttagagaaagccttcaagacagcgaatataaa
ccaacatatacagaaattttggtaaaaattgttgcaaaattattaacaaatgaagaaaac
aaactactaaattcttttattgaagataacaaaattaaggtagtttcaactgtaaatcta
ggcgttgcagtagctaccaattatggattggtggttccagttataaaaaatgcaaataat
aaggatttagttcaaatagtaaaagaattaagagaactgagcaataaagcaaagaacatg
cagcttacattagaagatatagaaggaggaacctttactttaacaaatttgggcatgttt
ggaatagattcatttactcctataattaatcctcctcaaactggtattttgggggtagga
agaatatataaaagaccagaatttgatgaaaacaataatgttataccttcttatttaaca
tggctgagcctaacctttgatcatagagttctagatggagcaagtgctgcgatatttttg
aaagaactatctgaaatattagatgatgataaaaaaattcaagctattgtctaa

DBGET integrated database retrieval system