KEGG   Caldisphaera lagunensis: Calag_0308Help
Entry
Calag_0308        CDS       T02380                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
clg  Caldisphaera lagunensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calag_0308
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calag_0308
   00020 Citrate cycle (TCA cycle)
    Calag_0308
   00620 Pyruvate metabolism
    Calag_0308
Enzymes [BR:clg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Calag_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328382..329095
Genome map
AA seq 237 aa AA seqDB search
MEKNNSLPIKEIIEFDPIRQTIAERMMSSLQNSAQLTLMREAKVNGLVKFRESLQDSEYK
PTYTEILVKIVAKLLTNEENKLLNSFIEDNKIKVVSTVNLGVAVATNYGLVVPVIKNANN
KDLVQIVKELRELSNKAKNMQLTLEDIEGGTFTLTNLGMFGIDSFTPIINPPQTGILGVG
RIYKRPEFDENNNVIPSYLTWLSLTFDHRVLDGASAAIFLKELSEILDDDKKIQAIV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaataacagcctacctattaaagaaataatagaatttgatccaataaggcaa
actatagcagaaagaatgatgagtagcctacaaaactcagcacaattaactcttatgaga
gaagcaaaggtaaatggtttggttaaatttagagaaagccttcaagacagcgaatataaa
ccaacatatacagaaattttggtaaaaattgttgcaaaattattaacaaatgaagaaaac
aaactactaaattcttttattgaagataacaaaattaaggtagtttcaactgtaaatcta
ggcgttgcagtagctaccaattatggattggtggttccagttataaaaaatgcaaataat
aaggatttagttcaaatagtaaaagaattaagagaactgagcaataaagcaaagaacatg
cagcttacattagaagatatagaaggaggaacctttactttaacaaatttgggcatgttt
ggaatagattcatttactcctataattaatcctcctcaaactggtattttgggggtagga
agaatatataaaagaccagaatttgatgaaaacaataatgttataccttcttatttaaca
tggctgagcctaacctttgatcatagagttctagatggagcaagtgctgcgatatttttg
aaagaactatctgaaatattagatgatgataaaaaaattcaagctattgtctaa

DBGET integrated database retrieval system