KEGG   Caldisphaera lagunensis: Calag_0480Help
Entry
Calag_0480        CDS       T02380                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
clg  Caldisphaera lagunensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calag_0480
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Calag_0480
   00640 Propanoate metabolism
    Calag_0480
   00660 C5-Branched dibasic acid metabolism
    Calag_0480
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Calag_0480
Enzymes [BR:clg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Calag_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
477296..478429
Genome map
AA seq 377 aa AA seqDB search
MKLFEFEAKEIIKNYGFEIPQSVLIKKGDDIEKKIRESKMEPPFAVKAQVLVAGRGKSGG
IKIVKTVEDAVKTAQTLFETSIKGIKPSYILIEKAIPHDKELYVGIVIDRSLRKPVVLAS
KFGGVDIEEIARNNPESIIRYPIDTFIGLRNYEARIIGKSIGVSGKALGSFEKFLTTLYK
AFIEYDAELAESNPLAYLEDKVIPLDLRITIDDNSLYRHENYAAKEEERLGENTEYEIKA
HELDLAFVELDGDIGVLGNGAGLTMTTMDLIYEYGGKPANFLDMGGGAEAEHVKTCVKFL
LDYPKAKKIFINMFGGITRADEVAKGVVMALNESSVKKPIVIRLTGTNEEQGKEILKQAG
IEAYNDPIEAVKSVVGK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactatttgaattcgaagcaaaagaaataataaaaaattatgggtttgaaatcccg
caaagtgtattaattaaaaagggagatgatatagaaaaaaagataagagaatcaaaaatg
gaaccaccatttgctgttaaggcccaggttttagttgctggaagaggaaaatcaggtggg
ataaaaatagttaaaactgtagaagatgctgtaaaaacagctcaaacattatttgaaact
tcaattaagggcataaagccttcttacattttaattgaaaaagctattccacatgataaa
gaattatatgttggaatagtaattgatagatctctaagaaagccagttgttttagcttct
aagttcggaggagtagatatagaagaaatagcaagaaataatccagaaagtataattagg
tacccaattgatacatttataggattaagaaattatgaggcaagaattattggtaaaagc
attggtgttagtggaaaagccttaggaagctttgaaaaattcttaacaacactatacaaa
gcatttattgaatatgatgcagaactagcagaaagtaatccgttagcgtatttagaagat
aaggttataccattagaccttagaataacaatcgatgataattcattatatagacatgag
aactatgcagcaaaggaagaagaaaggcttggtgaaaatactgaatatgaaataaaagct
cacgaattagatctagccttcgttgagcttgatggagacattggagtattaggaaatggg
gctggactaactatgacaactatggatttaatttatgaatatggaggaaaacctgcaaac
ttcttagatatgggaggaggagcagaagctgagcatgtaaagacttgtgttaaattctta
ttggattatccgaaggcaaagaaaatcttcataaatatgtttggaggaataacaagagct
gatgaagtagctaaaggagtagtcatggcattaaatgaatcatcagttaagaaacctata
gtaataagattaactggaacaaatgaagaacaaggaaaagaaatattaaaacaggctggg
atagaagcatataatgatcctatagaagcagttaaatctgtagttggtaaataa

DBGET integrated database retrieval system