KEGG   Caldisphaera lagunensis: Calag_0480Help
Entry
Calag_0480        CDS       T02380                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
clg  Caldisphaera lagunensis
Pathway
clg00020  Citrate cycle (TCA cycle)
clg00640  Propanoate metabolism
clg00660  C5-Branched dibasic acid metabolism
clg00720  Carbon fixation pathways in prokaryotes
clg01100  Metabolic pathways
clg01110  Biosynthesis of secondary metabolites
clg01120  Microbial metabolism in diverse environments
clg01130  Biosynthesis of antibiotics
clg01200  Carbon metabolism
Module
clg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Calag_0480
   00640 Propanoate metabolism
    Calag_0480
   00660 C5-Branched dibasic acid metabolism
    Calag_0480
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Calag_0480
Enzymes [BR:clg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Calag_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA GARS_A ATP-grasp_5 ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFZ70246
UniProt: L0A8S5
Position
477296..478429
Genome map
AA seq 377 aa AA seqDB search
MKLFEFEAKEIIKNYGFEIPQSVLIKKGDDIEKKIRESKMEPPFAVKAQVLVAGRGKSGG
IKIVKTVEDAVKTAQTLFETSIKGIKPSYILIEKAIPHDKELYVGIVIDRSLRKPVVLAS
KFGGVDIEEIARNNPESIIRYPIDTFIGLRNYEARIIGKSIGVSGKALGSFEKFLTTLYK
AFIEYDAELAESNPLAYLEDKVIPLDLRITIDDNSLYRHENYAAKEEERLGENTEYEIKA
HELDLAFVELDGDIGVLGNGAGLTMTTMDLIYEYGGKPANFLDMGGGAEAEHVKTCVKFL
LDYPKAKKIFINMFGGITRADEVAKGVVMALNESSVKKPIVIRLTGTNEEQGKEILKQAG
IEAYNDPIEAVKSVVGK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactatttgaattcgaagcaaaagaaataataaaaaattatgggtttgaaatcccg
caaagtgtattaattaaaaagggagatgatatagaaaaaaagataagagaatcaaaaatg
gaaccaccatttgctgttaaggcccaggttttagttgctggaagaggaaaatcaggtggg
ataaaaatagttaaaactgtagaagatgctgtaaaaacagctcaaacattatttgaaact
tcaattaagggcataaagccttcttacattttaattgaaaaagctattccacatgataaa
gaattatatgttggaatagtaattgatagatctctaagaaagccagttgttttagcttct
aagttcggaggagtagatatagaagaaatagcaagaaataatccagaaagtataattagg
tacccaattgatacatttataggattaagaaattatgaggcaagaattattggtaaaagc
attggtgttagtggaaaagccttaggaagctttgaaaaattcttaacaacactatacaaa
gcatttattgaatatgatgcagaactagcagaaagtaatccgttagcgtatttagaagat
aaggttataccattagaccttagaataacaatcgatgataattcattatatagacatgag
aactatgcagcaaaggaagaagaaaggcttggtgaaaatactgaatatgaaataaaagct
cacgaattagatctagccttcgttgagcttgatggagacattggagtattaggaaatggg
gctggactaactatgacaactatggatttaatttatgaatatggaggaaaacctgcaaac
ttcttagatatgggaggaggagcagaagctgagcatgtaaagacttgtgttaaattctta
ttggattatccgaaggcaaagaaaatcttcataaatatgtttggaggaataacaagagct
gatgaagtagctaaaggagtagtcatggcattaaatgaatcatcagttaagaaacctata
gtaataagattaactggaacaaatgaagaacaaggaaaagaaatattaaaacaggctggg
atagaagcatataatgatcctatagaagcagttaaatctgtagttggtaaataa

DBGET integrated database retrieval system