KEGG   Caldisphaera lagunensis: Calag_0567Help
Entry
Calag_0567        CDS       T02380                                 

Definition
2-oxoacid:ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
clg  Caldisphaera lagunensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calag_0567
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calag_0567
   00020 Citrate cycle (TCA cycle)
    Calag_0567
   00620 Pyruvate metabolism
    Calag_0567
   00640 Propanoate metabolism
    Calag_0567
   00650 Butanoate metabolism
    Calag_0567
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Calag_0567
   00680 Methane metabolism
    Calag_0567
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calag_0567
Enzymes [BR:clg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calag_0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(545932..546876)
Genome map
AA seq 314 aa AA seqDB search
MPVRLADFPRVRYGMPGNAACPGCPETMGLRYVKMALGDNVVLVIPAGCSSVIQGYTPKS
GINFPILNIVFASASSAAAGMEAAFEAQGKDATVVVWAGDGGTGDIGFQAMSGAAERNDN
ILYICADNEAYMNTGIQRSSLTPFGAWTTTTWTGKTEYKKNIPMIMIAHDVPYVATATVG
YPQDFIDKLRKASKIKGFKYIHLLAPDPVGWKFDPSLTAKLGQLAVQTGLFPLFEYENGK
LTVSVFSRLYRRPEKRVPIIEYIKVQGRYANLMKDPEKIKKLEEEIERQWKWIDILEKSS
NPSNVASQAIKENK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgccagttagattagcggattttccaagagtaagatatggaatgccaggtaatgctgcc
tgcccaggatgccctgaaactatgggtttaagatacgttaaaatggcccttggagataac
gttgttctagttattccagcaggatgtagtagtgtaatccaaggatatactccaaagagc
ggaataaacttccccatattaaacatagtctttgctagcgcatcaagtgcggcagcagga
atggaagcagcatttgaggctcaaggtaaagatgcaacagtagtagtatgggctggagat
ggaggaactggagatataggttttcaggctatgagtggggcagctgaaagaaacgataat
atattatacatatgtgcagataatgaagcttatatgaacacaggaattcaaagaagcagt
ttgacaccatttggtgcatggacgacaacaacatggactgggaaaacagaatataagaaa
aacataccaatgattatgattgctcatgatgtaccttatgttgctactgcaacagttggc
tatcctcaagattttatagataaattaagaaaagcttctaaaataaaaggatttaaatat
atacacctattagcccctgatccagtaggttggaaattcgatccaagtctcaccgctaaa
ttaggccaattagcagttcaaacaggtttgttcccattatttgaatatgaaaatggaaag
ctaacagttagcgtatttagtagattatatagaaggccagaaaaaagagttcctataata
gaatatattaaagttcaaggaagatacgctaatttaatgaaagaccctgaaaaaatcaaa
aaactagaagaagaaatagaaagacaatggaaatggattgatatcttagaaaaatcaagt
aatccaagcaatgttgcctctcaagcaataaaagaaaataaataa

DBGET integrated database retrieval system