KEGG   Caldisphaera lagunensis: Calag_0569Help
Entry
Calag_0569        CDS       T02380                                 

Definition
2-oxoacid:acceptor oxidoreductase subunit delta, pyruvate/2-ketoisovalerate family
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
clg  Caldisphaera lagunensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calag_0569
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calag_0569
   00020 Citrate cycle (TCA cycle)
    Calag_0569
   00620 Pyruvate metabolism
    Calag_0569
   00640 Propanoate metabolism
    Calag_0569
   00650 Butanoate metabolism
    Calag_0569
  Energy metabolism
   00680 Methane metabolism
    Calag_0569
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calag_0569
Enzymes [BR:clg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calag_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(548069..548374)
Genome map
AA seq 101 aa AA seqDB search
MTQNSQVIEEPKTYFLVPISKPDYGSSGKTGSWRTERPVVNEEKCTKCLYCWLYCPEDTI
LRREDDMVYVDYDYCKGCGICAAVCPVNAIDMVPEVKRGEN
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaatagtcaagtaatagaggaaccaaagacatactttttagtccctatatcc
aaacctgattatggctcttctggaaaaactggttcatggagaactgaaaggccagtagta
aatgaagaaaaatgtacaaaatgtctctattgttggctttattgtccagaagatacaata
ttaaggagggaagatgatatggtttatgttgattatgattattgtaagggttgtggaata
tgtgcagctgtttgtccagtaaatgcaatagatatggttcctgaagttaagagaggtgaa
aattaa

DBGET integrated database retrieval system