KEGG   Caldisphaera lagunensis: Calag_0757Help
Entry
Calag_0757        CDS       T02380                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
clg  Caldisphaera lagunensis
Pathway
clg00010  Glycolysis / Gluconeogenesis
clg00052  Galactose metabolism
clg00500  Starch and sucrose metabolism
clg00520  Amino sugar and nucleotide sugar metabolism
clg00521  Streptomycin biosynthesis
clg01100  Metabolic pathways
clg01110  Biosynthesis of secondary metabolites
clg01120  Microbial metabolism in diverse environments
clg01130  Biosynthesis of antibiotics
clg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calag_0757
   00052 Galactose metabolism
    Calag_0757
   00500 Starch and sucrose metabolism
    Calag_0757
   00520 Amino sugar and nucleotide sugar metabolism
    Calag_0757
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calag_0757
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Calag_0757
Enzymes [BR:clg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Calag_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hydant_A_N Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AFZ70501
UniProt: L0A9F3
Position
complement(744779..745732)
Genome map
AA seq 317 aa AA seqDB search
MKVIAIDIGATNLRVALFENNSKINEIKVKTPRDDPNSISKSIIKMINELSPNRDFQSIG
IGTIGPLNLKKGIIELAPNLGLKNIPLRDPLVNEFHKDVYIANDAMAAVWAEKILGDAKN
KNDLVYITMSSGIGVGAIIDGNLIVGRRGNSHEMGHSLVKFDSNLVCGCGKIGHWEAYAG
GKNIPKVAKEFANEWKGKESEGYFLAKENNLTPEKLYDLARKNDEFSKSLVDFLNIIHAA
GISNIIAAYDPEVIYIGGSIYLYNEDLIKPYLIKYIPMFSALGVPEIKMCTFGDDQVLYG
AASIAINPPSQIKKFNL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaatagcaattgatataggagcaacaaatttgagggtggcattattcgaaaat
aattctaaaattaacgaaataaaagtaaaaactcctagagatgatccaaactcaatttca
aaatcaataataaagatgataaatgagttatccccaaatagggactttcaatctattggt
attggaacaataggaccattgaatttaaagaaaggaattatagagcttgcaccaaattta
ggccttaaaaatattcctttaagagaccctctagttaatgaattccataaagatgtatat
atagcaaatgatgccatggctgcagtatgggctgaaaaaatccttggagatgcaaagaat
aaaaatgatttagtatatattactatgagctcaggcattggagttggggcaataattgat
ggaaatttaatcgtaggtagaagaggtaattcacatgaaatgggtcatagcctagttaaa
tttgattcaaatttagtttgtggttgtggtaagataggtcattgggaagcatatgcagga
ggcaaaaatatacctaaggttgctaaagagtttgcaaatgaatggaaaggtaaagaatct
gaaggatattttttagccaaagaaaacaatttgactccagaaaaactctatgatttagcg
agaaaaaatgatgaattttccaagtctttagtagatttcttaaacataatacatgctgct
ggtatatcaaatataatagccgcatatgatcctgaagttatatacataggaggtagtatt
tacctttataatgaggatcttataaagccatatttaattaaatacatacccatgtttagt
gcgttgggagttccagaaataaagatgtgcacatttggtgatgaccaggtattatatggg
gctgcgagtattgcaataaatcctccatctcaaataaagaagtttaatttataa

DBGET integrated database retrieval system