KEGG   Caldisphaera lagunensis: Calag_0757Help
Entry
Calag_0757        CDS       T02380                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
clg  Caldisphaera lagunensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calag_0757
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calag_0757
   00052 Galactose metabolism
    Calag_0757
   00500 Starch and sucrose metabolism
    Calag_0757
   00520 Amino sugar and nucleotide sugar metabolism
    Calag_0757
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calag_0757
   00524 Butirosin and neomycin biosynthesis
    Calag_0757
Enzymes [BR:clg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Calag_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(744779..745732)
Genome map
AA seq 317 aa AA seqDB search
MKVIAIDIGATNLRVALFENNSKINEIKVKTPRDDPNSISKSIIKMINELSPNRDFQSIG
IGTIGPLNLKKGIIELAPNLGLKNIPLRDPLVNEFHKDVYIANDAMAAVWAEKILGDAKN
KNDLVYITMSSGIGVGAIIDGNLIVGRRGNSHEMGHSLVKFDSNLVCGCGKIGHWEAYAG
GKNIPKVAKEFANEWKGKESEGYFLAKENNLTPEKLYDLARKNDEFSKSLVDFLNIIHAA
GISNIIAAYDPEVIYIGGSIYLYNEDLIKPYLIKYIPMFSALGVPEIKMCTFGDDQVLYG
AASIAINPPSQIKKFNL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaatagcaattgatataggagcaacaaatttgagggtggcattattcgaaaat
aattctaaaattaacgaaataaaagtaaaaactcctagagatgatccaaactcaatttca
aaatcaataataaagatgataaatgagttatccccaaatagggactttcaatctattggt
attggaacaataggaccattgaatttaaagaaaggaattatagagcttgcaccaaattta
ggccttaaaaatattcctttaagagaccctctagttaatgaattccataaagatgtatat
atagcaaatgatgccatggctgcagtatgggctgaaaaaatccttggagatgcaaagaat
aaaaatgatttagtatatattactatgagctcaggcattggagttggggcaataattgat
ggaaatttaatcgtaggtagaagaggtaattcacatgaaatgggtcatagcctagttaaa
tttgattcaaatttagtttgtggttgtggtaagataggtcattgggaagcatatgcagga
ggcaaaaatatacctaaggttgctaaagagtttgcaaatgaatggaaaggtaaagaatct
gaaggatattttttagccaaagaaaacaatttgactccagaaaaactctatgatttagcg
agaaaaaatgatgaattttccaagtctttagtagatttcttaaacataatacatgctgct
ggtatatcaaatataatagccgcatatgatcctgaagttatatacataggaggtagtatt
tacctttataatgaggatcttataaagccatatttaattaaatacatacccatgtttagt
gcgttgggagttccagaaataaagatgtgcacatttggtgatgaccaggtattatatggg
gctgcgagtattgcaataaatcctccatctcaaataaagaagtttaatttataa

DBGET integrated database retrieval system