KEGG   Caldisphaera lagunensis: Calag_0894Help
Entry
Calag_0894        CDS       T02380                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
clg  Caldisphaera lagunensis
Pathway
clg00260  Glycine, serine and threonine metabolism
clg01100  Metabolic pathways
clg01110  Biosynthesis of secondary metabolites
clg01120  Microbial metabolism in diverse environments
clg01230  Biosynthesis of amino acids
Module
clg_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calag_0894
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Calag_0894
Enzymes [BR:clg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Calag_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HypA Bac_surface_Ag
Motif
Other DBs
NCBI-ProteinID: AFZ70634
UniProt: L0AB46
Position
889670..890680
Genome map
AA seq 336 aa AA seqDB search
MFKMWKLFCKKCGFEGEEDKYYPFCPVCKSSLYIKGEKPKFNSILGEGNTPSVKENINGY
EVYFKMEYLNPTGSFKDRGVSYSLQLASSLKYKCAVEDSSGNTGISTAAYSSRLGLKSKI
VIPKTAPQGKKALLKSLNAEIIESNTRDEASLIAEDLSRSCFYVSHARNPFFIEGMKSIA
KEIEKIKPRGVIIPSSSFSLFLGTYYGLKEIGINAKMFAVQGIETASLKEFIDPIYESKG
KESKLADGLALKKSPRGEDAIKALKESNGGLIVLDDDEIKLGLKKLWQMGYMVEPTSATS
YIALIRLIELNYDVNDYVLMLTGNGLKFYDLIEKIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaaatgtggaagctattttgcaaaaaatgtgggtttgaaggagaagaagataaa
tattatcccttttgtccagtttgtaaatcatctctatatataaaaggggaaaagccaaaa
ttcaattctatattaggggaaggaaacactccttcagtaaaggaaaatataaatggctat
gaagtttatttcaaaatggagtatcttaaccctacaggaagctttaaagacagaggtgtt
tcatacagcctacaattagcctcatcgttaaaatataaatgcgctgtagaagattctagt
ggaaatactggtatatcaacggctgcttattcatctaggcttggattaaaaagtaagatt
gttatacctaagacagctccccaaggtaagaaagcattattaaagtcattaaatgccgaa
atcatcgaatctaatacaagggatgaagcttctttaattgctgaggatttatcaaggagc
tgtttttatgtttcccatgcaaggaatccattctttattgaagggatgaaaagtattgcg
aaagaaattgagaagattaaacctagaggtgttataataccttcctctagcttttctcta
tttttaggaacatattatggattaaaggagattggtataaatgcaaaaatgtttgcagtt
caaggaattgaaactgcatcgctaaaagaatttattgatcctatttatgaatcaaaagga
aaagaatctaagcttgcagatggtttagcattaaaaaagtctccaagaggagaagatgca
ataaaagcgttaaaagaaagtaatgggggattaatagtattagatgatgatgaaataaaa
ttaggattgaaaaaactttggcaaatgggatatatggtagagcctacttcagcaacatct
tatatagcattaattagacttatagagttaaattatgatgtaaatgattatgtattaatg
ctaactggaaatggattaaagttttatgatttaattgaaaaaatactttaa

DBGET integrated database retrieval system