KEGG   Caldisphaera lagunensis: Calag_0941Help
Entry
Calag_0941        CDS       T02380                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
clg  Caldisphaera lagunensis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Calag_0941
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calag_0941
Enzymes [BR:clg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Calag_0941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
945913..946470
Genome map
AA seq 185 aa AA seqDB search
MPFEFIKTSVDNVYIIRPKVFEDNRGYFMETFEKRSFSNLDFNVIQENQSYSRKGVLRGL
HFQKGKFAQAKIVRVIKGEIFDVAVDIRPDSKTFKKYVSAILSDKNKEMLYIPRGFAHGF
EVLSDEAIVVYLVDNFYSPENEGGIIWNDKDINIDWPIKEPILSKKDSSWPTLKQFLENE
RSEKR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgccctttgaatttattaaaacaagtgttgataacgtttatataataagacctaaagta
tttgaagataatagaggatattttatggaaacctttgagaaaagatcttttagcaatctt
gattttaatgttattcaagaaaatcaatcatattcaagaaaaggggttctaagaggtctt
cattttcaaaaaggtaaatttgctcaggcaaaaatcgttagagttattaaaggagagatc
tttgatgttgctgtagatataaggcctgattcaaaaacatttaaaaaatatgtttctgca
attttatctgataaaaataaggaaatgctttacataccaagaggttttgctcatggattt
gaagttttaagcgatgaagctatagtagtttatttggttgacaatttttattctccagaa
aatgaagggggaataatatggaatgataaagatataaatatagattggccaataaaagaa
ccaatattatcaaaaaaggatagctcatggccaactttaaaacaatttttagaaaatgaa
cgaagtgaaaaaagatga

DBGET integrated database retrieval system