KEGG   Caldisphaera lagunensis: Calag_0983Help
Entry
Calag_0983        CDS       T02380                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
clg  Caldisphaera lagunensis
Pathway
clg00020  Citrate cycle (TCA cycle)
clg00190  Oxidative phosphorylation
clg00650  Butanoate metabolism
clg00720  Carbon fixation pathways in prokaryotes
clg01100  Metabolic pathways
clg01110  Biosynthesis of secondary metabolites
clg01120  Microbial metabolism in diverse environments
clg01130  Biosynthesis of antibiotics
clg01200  Carbon metabolism
Module
clg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
clg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Calag_0983
   00650 Butanoate metabolism
    Calag_0983
  Energy metabolism
   00190 Oxidative phosphorylation
    Calag_0983
   00720 Carbon fixation pathways in prokaryotes
    Calag_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt HemY_N DUF846
Motif
Other DBs
NCBI-ProteinID: AFZ70706
UniProt: L0AA22
Position
998152..998505
Genome map
AA seq 117 aa AA seqDB search
MAGKASNIQVWQYITAILLIFLLGYHLLQRLPWLFNVSTFDQTLTSSFVYNQYQQAGWAL
LLLAWVALFHGLNGVRGMLFELHQGETYNKIINVLFWIVFIVFSAIAALTIIKLPPI
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaagcatctaatatccaggtttggcagtatataactgctatacttcttata
ttcttattaggatatcatttgttacaaagactaccatggctatttaatgtctctaccttt
gatcaaacattaacgagctctttcgtttataatcaatatcaacaagctggttgggcatta
ttgcttttggcatgggttgctctattccatggattaaatggtgtaagaggaatgctgttt
gaattacatcaaggagaaacttataacaaaataataaatgttcttttctggatagtattt
attgttttttcagctatagcagctcttacaataataaaattacccccaatatga

DBGET integrated database retrieval system