KEGG   Caldisphaera lagunensis: Calag_0983Help
Entry
Calag_0983        CDS       T02380                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
clg  Caldisphaera lagunensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calag_0983
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Calag_0983
   00650 Butanoate metabolism
    Calag_0983
  Energy metabolism
   00190 Oxidative phosphorylation
    Calag_0983
   00720 Carbon fixation pathways in prokaryotes
    Calag_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
998152..998505
Genome map
AA seq 117 aa AA seqDB search
MAGKASNIQVWQYITAILLIFLLGYHLLQRLPWLFNVSTFDQTLTSSFVYNQYQQAGWAL
LLLAWVALFHGLNGVRGMLFELHQGETYNKIINVLFWIVFIVFSAIAALTIIKLPPI
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaagcatctaatatccaggtttggcagtatataactgctatacttcttata
ttcttattaggatatcatttgttacaaagactaccatggctatttaatgtctctaccttt
gatcaaacattaacgagctctttcgtttataatcaatatcaacaagctggttgggcatta
ttgcttttggcatgggttgctctattccatggattaaatggtgtaagaggaatgctgttt
gaattacatcaaggagaaacttataacaaaataataaatgttcttttctggatagtattt
attgttttttcagctatagcagctcttacaataataaaattacccccaatatga

DBGET integrated database retrieval system