KEGG   Caldisphaera lagunensis: Calag_1026Help
Entry
Calag_1026        CDS       T02380                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
clg  Caldisphaera lagunensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:clg00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:clg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1035870..1036799
Genome map
AA seq 309 aa AA seqDB search
MVWSGHDVVNVLDFNREDLELLFSKADDMRKQLKENHVRKILSDKIIGLAFFEPSTRTRM
SFETAAKRLGAETVGFTGEEGTSVAKGESFADTIKMLDSYVDAIVLRHKYEGAALFAADV
AEHPIINGGDGRSHHPTQAFLDLYTTRTLFDRIDGLTFALVGDLKYSRTVSSLIFALSMF
KPKEIILISPPQLGLREEIKLFALNHGLKLREEKDISVISDADVIYVTRIQKERFPDLQE
YEKVRGSYKITKKLLETYAKKTAKVLHPLPRVDELSPDVDKTSYQGYFTQASLGVPLRMA
LLSLVLGGE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtatggtcaggtcatgatgttgtaaacgtgttagattttaatagagaagatttagaa
ttacttttctcaaaggcagatgatatgagaaaacaactaaaagaaaatcatgttagaaaa
attttaagtgataaaataataggattagcattttttgagccatcaacaagaacaagaatg
agctttgaaacggctgcaaaaagacttggagcagaaacagtaggttttactggagaagaa
ggaacaagcgttgctaagggagaatcattcgctgatacgattaagatgctcgattcgtat
gttgatgccattgtcttaagacataagtatgaaggagctgcattgtttgctgcagacgta
gcagaacatccaatcattaatggaggtgatggaaggtcgcatcaccctacacaggcgttt
cttgatttatatacaacgagaactttatttgatagaattgatggattaacatttgcttta
gttggagacctaaaatattctagaactgtttcaagcttaatctttgctctttctatgttt
aaacccaaggaaattattttaatatcacctcctcagctaggtcttagggaagaaataaaa
ttatttgcattgaatcatggtttaaagcttagggaagaaaaagatatcagtgttatttct
gatgcagatgtaatatatgtaacaagaatccagaaagaaagatttccagatcttcaagaa
tatgaaaaggttagaggaagctataagatcaccaaaaaattattggaaacatatgcaaag
aaaactgcaaaagtattgcaccccttgccaagggttgatgaattaagtccagatgtcgat
aaaacaagctaccaaggatattttacacaggcaagtctaggagtcccattaagaatggca
cttttatctttagttcttgggggtgaatga

DBGET integrated database retrieval system