KEGG   Caldisphaera lagunensis: Calag_1040Help
Entry
Calag_1040        CDS       T02380                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
clg  Caldisphaera lagunensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Calag_1040
Enzymes [BR:clg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Calag_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1047771..1048733)
Genome map
AA seq 320 aa AA seqDB search
MSDSKTIDITSIGHALMDMRFMVEKFAEPDEEADILEQSTGPGGSAVNVSLNVRKLGGTS
AIITKVGLDTFGRSIVEDLMKSKVDISGLKICFGETGFSIVIIDQQGNISIYGFKGCAEK
LEPKEIDSETISKSKIIHIASLRPDTSIRAAVVAKENDTLVSWDPGRRLSLRGLKELRGL
IKLVDIILLNEQECKNLTGIDNPEKCSQLLKSIGPENVIVKMGPKGLYANTNDFVGYMPA
FRVKEVRDSTGSGDAFAAAYLLSLTRGIKTVDALEFAQAVAALKVTKLGANAIPTQEEAL
EFLKQQKKLVNDEAHTGTNS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattcaaaaactattgatatcacatcaattggacacgcattgatggatatgaga
tttatggtagaaaaatttgcagaacctgatgaggaggctgatatactagaacaatctaca
ggaccagggggatccgcagttaatgtttctttaaatgtaagaaaattaggagggacatca
gctataataacaaaagttggcctagacacatttggaagatctatagttgaggatctaatg
aaatcaaaggtggatatatctggtttaaagatatgctttggagaaacaggattttcaata
gttataatagatcaacaaggaaatatttctatatatggatttaaggggtgtgctgaaaag
ctcgagcctaaagaaatagatagtgaaacgatatcaaagtctaagattatacatatagca
agtttgagaccagatacttctattagagctgccgtagtcgctaaagaaaatgatacctta
gtctcttgggatccagggaggaggttgagccttagaggattgaaagaactaagaggttta
ataaagttagttgatataatattgttaaacgagcaggagtgtaaaaacttaacaggtata
gataatccagaaaaatgcagtcaattattaaaatcaataggacctgaaaatgttattgtc
aaaatgggacccaaaggattatatgctaatacaaatgattttgtaggatatatgcctgca
tttagagttaaggaagttagggattcaacgggtagtggggatgcatttgcagcagcatat
ttgcttagtttaactagagggataaaaaccgttgatgcattagaatttgcacaagcagta
gctgctctaaaagttactaaactaggagctaatgctataccgactcaagaagaggcattg
gaatttcttaagcaacagaaaaaattagttaatgatgaagctcatacaggaacaaattca
taa

DBGET integrated database retrieval system