KEGG   Caldisphaera lagunensis: Calag_1088Help
Entry
Calag_1088        CDS       T02380                                 

Definition
2-oxoacid:acceptor oxidoreductase subunit gamma, pyruvate/2-ketoisovalerate family
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
clg  Caldisphaera lagunensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calag_1088
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calag_1088
   00020 Citrate cycle (TCA cycle)
    Calag_1088
   00620 Pyruvate metabolism
    Calag_1088
   00640 Propanoate metabolism
    Calag_1088
   00650 Butanoate metabolism
    Calag_1088
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Calag_1088
   00680 Methane metabolism
    Calag_1088
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calag_1088
Enzymes [BR:clg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calag_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1098807..1099382
Genome map
AA seq 191 aa AA seqDB search
MTTIEIRWHGRGGQGAVTAGEVLASGAIIEGKYALAFPEFGAERRGAPVRAYTRITDNPN
IPRTPIENPDVVVILDRSLLKKEYMEGLKKGGYIIANTPLKPDELIKKIDLPNSYNVSTV
DATSIALKWLKANIVNTAILGAVIKTTNLIKIDTIIEVLKNRFHGKIGESNAMAVKEAYD
STLVMKLQEAI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgactacaatagaaataagatggcatggaagagggggccaaggagctgttacagcagga
gaagtattagcatctggcgcaattatagaaggtaaatatgctttggcatttccagaattt
ggagctgaaagaagaggagcccctgtaagggcttatacaagaataacagataatccaaat
atacctagaactccaatagaaaatcctgatgtagttgttatattggatagaagcctttta
aagaaagaatacatggaagggcttaaaaaaggaggatatattatagcaaatacgccatta
aaaccagatgaattaattaagaagattgatttacctaatagctataacgtttcaacagtt
gacgcaacaagcatagcattaaaatggttaaaagcaaacatagtaaatactgcaattttg
ggtgcagtaataaaaactacaaatttaattaagattgatacaataatagaagttttaaag
aacagattccatggaaagattggggaatcaaatgcaatggcagttaaggaggcatatgat
tcaactttagttatgaaattacaagaggcgatttaa

DBGET integrated database retrieval system