KEGG   Caldisphaera lagunensis: Calag_1091Help
Entry
Calag_1091        CDS       T02380                                 

Definition
2-oxoacid:ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
clg  Caldisphaera lagunensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calag_1091
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calag_1091
   00020 Citrate cycle (TCA cycle)
    Calag_1091
   00620 Pyruvate metabolism
    Calag_1091
   00640 Propanoate metabolism
    Calag_1091
   00650 Butanoate metabolism
    Calag_1091
  Energy metabolism
   00680 Methane metabolism
    Calag_1091
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calag_1091
Enzymes [BR:clg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calag_1091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1100883..1101845
Genome map
AA seq 320 aa AA seqDB search
MSENKILRIKSLYDLPRDELFISGHGLCPGCTAGTIMRMLTKVTGKDTIIVNATGCVEVS
TTRYPYSNWLVPWFHSAFENSGASASGIAAAIKAMKRKGLMDKNKDVKVVVVAGDGGTVD
IGLQSLSGMLERKEPVMYVLYDNEAYMNTGIQRSGSTPHGAWTTTTPAGKVWRGEWRDKK
DIAGIAAAHHIPYVATANPAYPMDMINKFARGLEVLNEGPSFIQVLMACTTGWRFDPALG
ITISRLATETGIFPLYEIDHDNFRVTFPVMKRKPVKEYLKLQGRFAHLTDDEINEIQKLV
DQKVEAINKRAGKTVIGPIA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaataaaattttaaggataaaaagcctttatgatttacctagagacgagctg
tttataagcggccatggtttatgcccaggttgtactgctggaacaataatgagaatgtta
acaaaagtaaccggaaaagatacaataatagttaatgcaaccggttgtgtagaagtatca
acaacaagatatccatattcaaattggttagttccatggttccactcagcatttgaaaat
tctggggcatctgcaagcggtatagctgctgcaataaaagcaatgaaaagaaaagggtta
atggataaaaataaagacgttaaagttgttgtagtagcaggagatggaggaacagtagat
ataggtttacaaagcctaagcggtatgctagaaagaaaagaacctgttatgtatgtttta
tatgataacgaagcatatatgaatacaggtattcaaaggagtggttcaaccccgcatgga
gcatggactacaacaactccagcggggaaagtttggagaggtgaatggagggataagaaa
gatatagcaggtatagcagctgcacatcatattccttatgttgcaacagcaaacccagct
tatccaatggatatgataaataagtttgctagaggacttgaggtattaaatgaagggcca
tcatttatacaagttttaatggcatgcacaacgggttggcgttttgatcctgctttaggc
attactatatctagactagcaactgaaacaggtatattcccgctttatgaaatagatcac
gataacttcagagtaacttttccagtaatgaagagaaaacctgttaaagaatatttaaaa
ctacagggaagatttgctcatttaactgatgatgaaataaatgaaatacagaaattagtt
gatcaaaaagtagaggcaataaacaaaagggctggaaaaacagttataggaccaattgcc
taa

DBGET integrated database retrieval system