KEGG   Caldisphaera lagunensis: Calag_1125Help
Entry
Calag_1125        CDS       T02380                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
clg  Caldisphaera lagunensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:clg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1132813..1133784
Genome map
AA seq 323 aa AA seqDB search
MCIEYAEKLSKIIYENSRKNNCDCILFSGGIDTTFILMSLINEKPKTISVVFNESKDKEY
IDYVKNKLNIENYEIIIKNEQEIGDCLNNVLYSLKVIDPIEIISGVSVCLGLKKAKELKC
NCIITGDGGDELYFGYDFLLNRNESYLNNWLKNVLNNAFFNSIPISNYMGIKAILPLYSN
ESKELSLSIPTKCKINEINGKIYGKYFMRLWLMRKGLEFVALRNKTPITIGTGSEILLQS
WKNKVKKEEIQEYKNKYRINFPSLSHFYLFKKGLELGIFNDELENKSNKNPCPICGHEMK
GNHCKFCGTYIDEKGQISYYKDF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtgtattgaatatgcagaaaaattatctaaaattatatatgaaaattcacgaaaaaat
aattgtgattgcatcttgtttagtggaggaattgacacaacatttatcttaatgtcctta
ataaatgagaagcctaaaacaatttcagtagtgttcaatgaatctaaagataaggaatat
atagattatgttaaaaataaattaaatatagagaattatgaaattattataaaaaatgaa
caagaaataggcgattgtttaaataatgttttatattctttaaaagttattgatcctata
gaaataatttcaggtgtttcagtatgcttaggtcttaaaaaggcaaaggaacttaaatgc
aattgcattataactggtgatggaggagatgaactctattttggctacgatttcttatta
aatagaaatgaaagctatttaaataactggctaaaaaatgtgttgaataatgcatttttc
aattccattccaatatctaattatatgggaatcaaggctatattaccattatatagcaat
gaatctaaagaactttctttaagtattccgacaaaatgtaaaattaacgaaattaatggc
aaaatctatggaaaatattttatgaggctatggcttatgaggaaaggattagaattcgtt
gctttaagaaataaaacaccaataactattggtacaggatctgaaattttgttgcaaagt
tggaaaaataaagttaaaaaagaagaaatccaagaatataaaaacaaatatagaataaac
ttcccttcattatctcatttctacttatttaaaaaaggtcttgaattaggaatttttaat
gatgaattggaaaataaatcaaataagaacccttgtcctatatgtggtcatgaaatgaaa
ggaaatcattgtaaattttgcggtacatatattgatgaaaaaggacaaatttcttattat
aaagacttttaa

DBGET integrated database retrieval system