KEGG   Caldisphaera lagunensis: Calag_1420Help
Entry
Calag_1420        CDS       T02380                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
clg  Caldisphaera lagunensis
Brite
Enzymes [BR:clg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Calag_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1400146..1400820
Genome map
AA seq 224 aa AA seqDB search
MESFNKKMSLINYLKNSGFIKTKKVEEALINVDRANFVLSQYLSEAYEDKPLPIGYGQTI
SAPSIVAYMTELLEVNEGNKILEIGTGSGYQTAILSYLVKEKGLIVSIERIKELSEMAYK
NLERLGLHKNVKLIVGDGSLGYEEEKPYDRIIITAATPVVPKFINMQLKNNGIAILPLGT
LEEQKLAIIRKDEFGNIELRYDISVIFVPLIGYEGFKFGKEETN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggaaagctttaataagaaaatgtcattgataaattacttaaagaattcaggatttatt
aaaacaaagaaagtggaagaagctcttattaatgttgacagagctaactttgttttatca
caatatttaagtgaggcatacgaagataaaccattacctataggttacgggcaaacaatt
agcgccccaagtattgtagcatatatgacagagttattagaagttaatgaaggaaataaa
atcttagaaattggaactgggtcaggatatcaaactgcaatactatcatacctagttaaa
gaaaagggcttaattgtttcaatagaaagaataaaagagttatcagaaatggcttataaa
aaccttgaaagattaggtttgcataaaaatgtaaagttaattgttggagatggatctcta
ggatatgaagaagaaaagccttatgacagaataataataactgctgcaactccggttgtg
ccgaaatttattaatatgcaattaaaaaataatggtattgctatattacctttaggaaca
ttagaggaacaaaaactagccataattagaaaagatgaatttggaaatattgaattgcgt
tatgatatcagtgtaatatttgttccattaattggttatgaaggatttaaatttggtaaa
gaggaaacaaattaa

DBGET integrated database retrieval system