KEGG   Chlorobium limicola: Clim_0261Help
Entry
Clim_0261         CDS       T00766                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cli  Chlorobium limicola
Brite
Enzymes [BR:cli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Clim_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_23 Methyltransf_11 Methyltransf_25 TehB
Motif
Other DBs
NCBI-ProteinID: ACD89356
JGI: Clim0261
UniProt: B3EEX3
Position
293640..294293
Genome map
AA seq 217 aa AA seqDB search
MDASDRSMAVKRMEMVQSLRQKGLVNERVLDAMQRIERHRFVDRESSVSAYEDSAYPIGY
GQTISQPYTVAYMTTLLLERCPPPGKVLEIGTGSGYQAAILDALGYRVYSVERIPELHDR
VVGLFRSLGLAISCRVGDGSLGWEEEAPFDGIMVTAAAPRCPEHLLEQLGDNGCLVIPVG
EHNMQQMTVYRRVGERFEKELFHHFAFVPLIGREGWN
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatgcatcagacagatcaatggcggtgaaacgcatggagatggttcagagtctcagg
cagaaaggtctggtcaatgaacgggtactcgatgcgatgcagaggatagagcggcatcgg
ttcgttgacagggaaagttctgtttctgcttatgaagactcggcttatccgatagggtat
ggccaaaccatatcgcagccttatacagtggcctatatgaccacgctgcttctggagcgt
tgtcctccgcccggaaaggttcttgaaatcggtaccggatcgggctaccaggccgcaatt
ctcgatgcgctgggttaccgggtttattccgtagagcgcatcccggaactccatgaccgg
gttgtcgggttgttcagaagtctcgggcttgcgatttcatgcagggttggcgacggttct
ctgggttgggaggaggaggctccatttgacggcattatggtaaccgcagcagctccgcgc
tgtccggagcatcttttagagcaactcggagataacggatgtcttgttattcccgtcggt
gaacataatatgcagcagatgaccgtttaccggcgcgttggggagaggtttgaaaaggaa
ctgtttcatcatttcgcatttgtgccgctgatcggcagggaaggctggaactga

DBGET integrated database retrieval system