KEGG   Chlorobium limicola: Clim_0321Help
Entry
Clim_0321         CDS       T00766                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cli  Chlorobium limicola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clim_0321 (ruvA)
Enzymes [BR:cli01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Clim_0321 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
355545..356156
Genome map
AA seq 203 aa AA seqDB search
MFAYFRGRLTSAMPDEAVVDVSGIGYRFLVSAFTYRQLPPPGEDVLLYAHLSVKEDAFLL
YGFSSESERQLFRLLLLTTGVGPKLALAVLSGLQVHEVHEAIMANAPERLYGISGVGKKT
AARIILELRDRILKMSPDGGKTIASGSGGNLALQIKDDALNALITLGFSKPAAQKAVTGI
LEGNPSLSVEEVVKSALVSIHNS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatatttccggggcaggctgacttcagccatgccggatgaagcggttgtcgat
gtatcaggtatcgggtaccgctttcttgtttcggcgtttacctatcggcaacttccgccg
ccgggcgaagatgtgcttttatatgcgcacctttcggtcaaagaggacgcattcctgctt
tacggtttttcaagcgaatccgagcggcagctgttccgtctgcttctgcttacgaccggg
gtgggtccgaaacttgcccttgccgtgctttccggacttcaggttcatgaagttcacgaa
gccatcatggctaacgctcctgaacggctttatggcatcagtggcgtcggaaaaaaaaca
gcggccagaattatcctcgaattacgcgacagaattctcaaaatgtctcctgacggcgga
aaaaccattgcttccggttcgggaggcaacctcgctctgcagataaaagacgatgctctc
aatgcgcttattacccttggtttttcaaaaccggcggcgcagaaagccgtaacgggcatt
ctggagggtaatccgtcactcagcgtcgaggaggtggtgaagtccgcacttgtttctatt
cataacagttag

DBGET integrated database retrieval system