KEGG   Chlorobium limicola: Clim_0452Help
Entry
Clim_0452         CDS       T00766                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cli  Chlorobium limicola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clim_0452
   01230 Biosynthesis of amino acids
    Clim_0452
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clim_0452
   00030 Pentose phosphate pathway
    Clim_0452
   00051 Fructose and mannose metabolism
    Clim_0452
   00052 Galactose metabolism
    Clim_0452
  Energy metabolism
   00680 Methane metabolism
    Clim_0452
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Clim_0452
Enzymes [BR:cli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clim_0452
Protein phosphatases and associated proteins [BR:cli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Clim_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
512845..513864
Genome map
AA seq 339 aa AA seqDB search
MTDKNNVPNVSQKRVKLRRIGVFTSGGDAPGMNAAIRAVTRAAIANKLKVVGIRRGYQGM
IEGDFIPLKSADVSGIIQLGGTILKTARSAEFRTPEGREKAWLQLQKADIDAVVVIGGDG
SFTGALTMSQEYNISFVGIPGTIDNDMYGTDYTIGYETALNTVVCAVDKIRDTAVSHGRI
FLVEVMGREAGLLALNSGIACGAEVILIPESKEQHDELKRFLDKGYKNKERSGIVIVAEG
DEPGGALKIAEAVGRDHPDLDVRVSILGHIQRGGSPTANDRINATRMGIAAVDALLDDQK
SVMIGLDNGKIVQVPFNKAVKLNHSIDTGLLDIQKMLSM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacagataaaaataacgtaccgaacgtttctcagaagagagtgaagttacgcaggatc
ggcgtgtttacttccggtggggatgctccgggcatgaatgcggctatcagggcggtgacc
cgtgcggctattgcgaacaaactgaaagtggtcggcatccgccgcgggtatcaggggatg
atagagggagatttcattccgctgaagtcggcagatgtcagcggtattatccagttgggc
gggacgattctaaaaacggcacgcagcgccgaattcagaactcccgaaggccgcgaaaaa
gcctggctgcagttgcagaaagccgacatcgacgcggttgtggtgatcggaggcgacggt
tcctttaccggagcgctgacgatgtcgcaggagtacaacatctcgtttgtaggcatcccg
ggtaccatcgataacgatatgtacggcacggattataccatcggttatgaaacggcgttg
aataccgtcgtgtgcgccgtcgataaaataagggatacggcagtatcgcacggcaggatt
tttctggtcgaggtcatgggccgcgaagccggtctgcttgctctgaacagcgggatagcc
tgcggggcagaggtgattctgattcctgaatcgaaggaacagcacgacgagctgaagcgg
tttctcgataaggggtataaaaacaaggagagaagcgggatcgttattgttgccgaaggg
gatgagcccggaggtgcgctgaaaatagccgaagcggtcggcagggatcatcccgacctt
gatgtgcgggtttccattcttggccatatacagcgaggggggagtccgacggccaacgac
cggataaacgcaacgaggatgggcatagcggcagtcgatgctttgctcgacgatcagaag
agcgtcatgatcggacttgataatggaaaaatcgtacaggtgccgttcaataaagccgtg
aaactgaatcacagcatcgataccggtctgctcgatatacagaagatgctcagtatgtag

DBGET integrated database retrieval system