KEGG   Chlorobium limicola: Clim_0452Help
Entry
Clim_0452         CDS       T00766                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cli  Chlorobium limicola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:cli01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cli01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cli00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cli00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cli00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cli00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cli00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
512845..513864
Genome map
AA seq 339 aa AA seqDB search
MTDKNNVPNVSQKRVKLRRIGVFTSGGDAPGMNAAIRAVTRAAIANKLKVVGIRRGYQGM
IEGDFIPLKSADVSGIIQLGGTILKTARSAEFRTPEGREKAWLQLQKADIDAVVVIGGDG
SFTGALTMSQEYNISFVGIPGTIDNDMYGTDYTIGYETALNTVVCAVDKIRDTAVSHGRI
FLVEVMGREAGLLALNSGIACGAEVILIPESKEQHDELKRFLDKGYKNKERSGIVIVAEG
DEPGGALKIAEAVGRDHPDLDVRVSILGHIQRGGSPTANDRINATRMGIAAVDALLDDQK
SVMIGLDNGKIVQVPFNKAVKLNHSIDTGLLDIQKMLSM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacagataaaaataacgtaccgaacgtttctcagaagagagtgaagttacgcaggatc
ggcgtgtttacttccggtggggatgctccgggcatgaatgcggctatcagggcggtgacc
cgtgcggctattgcgaacaaactgaaagtggtcggcatccgccgcgggtatcaggggatg
atagagggagatttcattccgctgaagtcggcagatgtcagcggtattatccagttgggc
gggacgattctaaaaacggcacgcagcgccgaattcagaactcccgaaggccgcgaaaaa
gcctggctgcagttgcagaaagccgacatcgacgcggttgtggtgatcggaggcgacggt
tcctttaccggagcgctgacgatgtcgcaggagtacaacatctcgtttgtaggcatcccg
ggtaccatcgataacgatatgtacggcacggattataccatcggttatgaaacggcgttg
aataccgtcgtgtgcgccgtcgataaaataagggatacggcagtatcgcacggcaggatt
tttctggtcgaggtcatgggccgcgaagccggtctgcttgctctgaacagcgggatagcc
tgcggggcagaggtgattctgattcctgaatcgaaggaacagcacgacgagctgaagcgg
tttctcgataaggggtataaaaacaaggagagaagcgggatcgttattgttgccgaaggg
gatgagcccggaggtgcgctgaaaatagccgaagcggtcggcagggatcatcccgacctt
gatgtgcgggtttccattcttggccatatacagcgaggggggagtccgacggccaacgac
cggataaacgcaacgaggatgggcatagcggcagtcgatgctttgctcgacgatcagaag
agcgtcatgatcggacttgataatggaaaaatcgtacaggtgccgttcaataaagccgtg
aaactgaatcacagcatcgataccggtctgctcgatatacagaagatgctcagtatgtag

DBGET integrated database retrieval system