KEGG   Chlorobium limicola: Clim_0491Help
Entry
Clim_0491         CDS       T00766                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cli  Chlorobium limicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clim_0491
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clim_0491
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clim_0491
Enzymes [BR:cli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clim_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(555247..556446)
Genome map
AA seq 399 aa AA seqDB search
MSSSAYSAPDAKGHFGVFGGKFIPETLIKNASDLESEYRKANNDPSFHATLENLLRDYVG
RPTPLYHAERLSRAVQGAAIYLKREDLCHTGAHKINNALGQALLARRMGKKRIIAETGAG
QHGVATATVCALFDLDCIVYMGEEDIRRQAPNVARMKLLGAEVRPVTSGSRTLKDATSEA
IRDWMNNPEETFYIIGSVVGMHPYPMIVRDFQAVIGKETRKQILEQAGRLPDVITACVGG
GSNAIGMFHEFLDDVPAIELVGVEAAGEGLEGLHAASLTLGTPGVLHGAMTKLLQTDDGQ
ILEAHSISAGLDYPGVGPEHCHLQETGLVSYTSATDHEALLALKTLAETEGIICALESAH
AVHYAIKKAATMSPESILVANLSGRGDKDMKTIMDSLNL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcttctgcgtattctgctcccgatgccaagggacacttcggagttttcggcggg
aaattcatccccgaaaccctgataaaaaacgcttcagatcttgaatcggaatatcggaaa
gccaacaacgatccgtcgtttcacgcgacacttgaaaacctgcttcgagactacgtagga
cgcccgactcccctctatcatgccgaaaggctgagcagggcagttcagggcgcagcaatc
tacctgaaacgcgaagatctctgccacaccggagcccacaagatcaacaacgccctgggg
caagcgcttctcgcccggcggatgggcaaaaaacggatcatagccgaaaccggtgccggt
cagcatggagttgcaacagctacggtatgcgcactgttcgatcttgactgcattgtctat
atgggtgaagaggatatcaggcgtcaggctcccaatgtagcaagaatgaagctgctcggc
gccgaggtccggccggtcacctccggttccagaacgctcaaggacgctaccagcgaggcc
attcgggactggatgaacaacccggaagagactttttatattatcggttccgtcgttggc
atgcatccatacccgatgatcgtgcgtgattttcaggcggtaatcggcaaagaaaccaga
aaacagattcttgaacaggcaggcagactgccggatgtcattaccgcatgcgtagggggc
ggaagcaatgccatcggcatgttccatgaatttctcgacgatgtcccggctattgagctt
gtcggagtcgaagccgccggcgaaggcctcgaaggccttcatgccgcatcactgacgctc
ggaacccctggtgttctgcacggagcaatgaccaagctgctgcaaaccgatgacggccag
attctcgaagcccactcgatatctgccggcctcgactatcccggcgtagggcccgaacac
tgccacctgcaggaaaccggactggtcagctacacctcggcaaccgaccatgaagcgctg
cttgcactcaaaacccttgctgaaaccgaagggatcatctgcgcccttgaatcggcgcat
gccgtgcactacgcaatcaaaaaggctgcgaccatgagccctgaatccattctcgtcgcg
aacctttccggacgcggcgacaaggatatgaaaaccattatggactccctcaacctctga

DBGET integrated database retrieval system