KEGG   Chlorobium limicola: Clim_0501Help
Entry
Clim_0501         CDS       T00766                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cli  Chlorobium limicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clim_0501
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clim_0501
Enzymes [BR:cli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clim_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
567835..568638
Genome map
AA seq 267 aa AA seqDB search
MKQNRIASLVEQDKKLLVAYYMPEYPVAGATLPVLEALQENGADIIELGIPFSDPVGDGP
VIQEAAQRAIRNGVTVKNLLETVHNARRGAGCKAITVPIILMGYCNPLIAYGGDCFLNDA
VEAGVDGLLLPDLPPEEAEDFLERAKSFGLTVVFLISPVTPPDRIEMIDSLSTDFSYCLA
VNATTGTAKLAGEDADAAIEEYLKRVRQHTRKKFVVGFGIRDKARVMQMWKLADGAVVGT
ALLQRLAAAHTPGETARLAGEFWQALR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaatcgtatcgcttcgcttgtcgagcaggataaaaaactgcttgtcgcttat
tatatgcctgaatatccggtagcgggagcaacccttccggtgctcgaagccctccaggaa
aacggtgcggatattatcgaactcggtattcctttttccgatcccgtcggtgatggtccg
gttatacaggaggctgcacaaagagctatcaggaacggcgtaaccgttaaaaatcttctc
gaaacggtgcacaacgcccgacggggtgcagggtgtaaggcaattacggttcccatcatt
ctcatggggtactgcaatccgctgatcgcctacggaggggactgttttctgaatgatgcc
gtcgaggcgggcgttgacgggcttctgcttcccgatctcccgcctgaagaggccgaagat
tttcttgaaagggcaaaaagcttcgggttgaccgtggtttttctcatctcgccggttact
ccgcccgaccggatcgagatgatcgattctctttcgacggatttttcctattgtctggca
gtcaatgccacaaccggtaccgccaaacttgccggagaggatgcagatgccgcgatcgag
gagtatctcaaacgggtcaggcagcatacccggaaaaaatttgtcgtaggtttcggtatc
agggacaaggccagagtcatgcagatgtggaagcttgcagacggagccgttgtggggaca
gcacttctgcagcgccttgccgcggcccatacgcctggggaaactgcccgtcttgccgga
gagttctggcaggcactccgataa

DBGET integrated database retrieval system