KEGG   Chlorobium limicola: Clim_0513Help
Entry
Clim_0513         CDS       T00766                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cli  Chlorobium limicola
Pathway
cli00340  Histidine metabolism
cli01100  Metabolic pathways
cli01110  Biosynthesis of secondary metabolites
cli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Clim_0513
Enzymes [BR:cli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Clim_0513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACD89605
JGI: Clim0513
UniProt: B3EGG8
Position
578273..579559
Genome map
AA seq 428 aa AA seqDB search
MLNIYRYETDREALKKQLERSVTFEPEVERTVHDILAAVRSGGDKALLDYTERFQGVRLQ
EMTVSGEEIRRAYEQADSRFIGVLEEAYRNITAFHRHEIEKSFFYEAEGGVILGQRVTPM
ERAMLYVPGGKAAYPSSLLMNAAPAQVAGVGQIFLTTPCDSEGNVSSHILAAAAVAGIGS
VYKLGGAQAVAAFAFGTESIPKVDSITGPGNKYVALAKKQVFGHVAIDSIAGPSEVVIIA
DESADPDFIVLDMFAQAEHDPDASAVLITPSESLADAVRQRAANRIETMLRKEVIAASLS
SNGAVVITGSMEEACRVSDSLAPEHLELHVENPWDLLGSIHHAGAIFMGAYSCETVGDYF
AGPNHTLPTNGTARFFSPLSVRDFIKHTSIISYSRRQLLSCGEKIASFADHEGLQAHAEA
VRERLRKA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaacatctaccgttatgaaactgacagagaggctctgaaaaagcagctggagcga
agcgttacgtttgaacctgaagttgagcgtaccgttcacgatattctcgctgcggtgcgt
tccggaggcgacaaggcactgcttgactataccgaacgttttcagggggtcaggctgcag
gaaatgacagtttccggtgaagagatccggagagcttatgagcaggccgattcccgtttt
atcggggtgcttgaagaggcttaccggaacatcacggcgtttcaccgccatgagattgaa
aaaagttttttctatgaagcagagggcggcgttatactcgggcagcgggttactcccatg
gagagagccatgctttacgtgccgggaggaaaagccgcctatccgtcgtcgctgcttatg
aatgccgctcccgcacaggttgccggtgtcggtcagatatttcttactactccctgcgat
tccgaaggaaacgtcagttcccatatacttgccgctgctgccgttgccggtatcggaagt
gtctacaagctcggcggagcacaggctgtggctgcgtttgcctttggaacggagagtatc
ccgaaagttgacagtataacaggccccggcaacaagtatgtcgctctcgctaaaaagcag
gtgttcggtcatgttgccatcgacagtattgcggggccttccgaggtggtcattattgcc
gatgagtcagccgatcctgattttattgtgcttgacatgtttgcgcaggccgagcacgat
cccgatgcttcggcggtgttgatcaccccttcggaatcccttgcagacgcggtccggcaa
cgtgccgcgaatcgtatcgaaacgatgcttcgtaaagaggttatcgccgcatcgctttcg
tccaacggggctgtcgttatcaccggttccatggaggaggcctgtcgggtttccgattcg
ctggcacctgaacaccttgaactgcatgtcgaaaatccatgggatcttctcgggagtatc
catcatgccggagcgatatttatgggcgcctattcctgtgaaaccgtcggcgactatttc
gccggccctaaccataccctgcccaccaacggaaccgcaaggtttttctcgccgctttcg
gttcgcgattttatcaaacacacctcgatcatctcctactcaaggagacaactgctctca
tgcggcgagaaaatcgcatcgttcgcagaccacgaggggctgcaggctcatgccgaggcc
gtccgggagcgtctcagaaaggcatga

DBGET integrated database retrieval system