KEGG   Chlorobium limicola: Clim_0876Help
Entry
Clim_0876         CDS       T00766                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cli  Chlorobium limicola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clim_0876 (recR)
DNA repair and recombination proteins [BR:cli03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Clim_0876 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
958851..959468
Genome map
AA seq 205 aa AA seqDB search
MRYTSAAIETLIEEFAKLPGIGRKTAQRLAMHILHEPKSGAERLAGALIDIKEKVIRCSV
CQNVTDRDADPCYICSSTGRDRSVICVVESPADVLAFEKTGHYKGQYHVLHGLVSPLDGI
GPDDIRIHELLARLGERHEAVPVKEVVLALNPTVEGETTSLYITRLLKPFGISVTKIARG
IPVGAELEFIDEATLSRAMEGRSAV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatacttcggcggccattgaaaccctgatcgaagagtttgccaaactgccgggt
ataggtcgtaaaaccgctcagcgtcttgccatgcatatactgcatgaaccgaagtcagga
gccgaaaggcttgccggtgcgttgatcgatataaaagaaaaggttatccgctgttcagtc
tgccagaacgttaccgaccgcgatgccgatccctgttatatatgcagcagcacaggccgt
gacaggtctgtcatctgtgttgtcgagtcgcctgcagacgtcctggcttttgaaaaaacc
ggtcattataaaggacagtatcatgtgcttcacggccttgtctcaccgcttgacggcata
ggacctgacgacatcaggattcacgagttgcttgccagactcggagagcggcatgaagcg
gttccggtaaaagaggtcgtgcttgctctcaatcctacagtagagggagagacaacctct
ctctacattaccaggctgcttaaaccttttggtatctccgttacaaagattgcccggggt
attccggttggtgccgagctcgagtttattgacgaagcaacgctttcccgcgctatggag
ggtcgctcagcggtgtag

DBGET integrated database retrieval system