KEGG   Chlorobium limicola: Clim_0882Help
Entry
Clim_0882         CDS       T00766                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cli  Chlorobium limicola
Pathway
cli00860  Porphyrin and chlorophyll metabolism
cli01100  Metabolic pathways
cli01110  Biosynthesis of secondary metabolites
cli01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Clim_0882
Enzymes [BR:cli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Clim_0882
Exosome [BR:cli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clim_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DUF2493
Motif
Other DBs
NCBI-ProteinID: ACD89961
JGI: Clim0882
UniProt: B3EID1
Position
complement(966504..967490)
Genome map
AA seq 328 aa AA seqDB search
MSQLDLLNIVHRPRRLRKSAAIRNLVQERTLTVNDLVFPLFVCPGTNVVEEVLSMPGSFR
YSIDNAVKECQELWDLGIQCIDLFGIPEKKTEDGSESYNDKGIIQEAIRAIKAKVPDLCI
MTDVALDPFTPFGHDGLVRDGIILNDETVEVLCKMAASHANAGADFVSPSDMMDGRIGAI
RESLDDAGFSDVGILSYAAKYASSFYGPFRDALHSAPQFGDKTTYQMNPGNTDEAMKEIE
LDIMEGADIVMVKPGLAYLDIVYRTKERFDVPVAIYHVSGEYAMVKAAAEKGWIDEERVM
MESLLCMKRAGGDMIFTYYAKEAAKRLR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagctcgatcttctcaatattgttcatcgcccaagaaggctccggaaatcggcc
gctataagaaaccttgttcaggaacgcaccctgacagtaaacgaccttgtgtttccgttg
ttcgtctgccccggaaccaatgttgttgaagaagtgctgtccatgccgggtagtttccgt
tactctatcgacaacgcggtcaaagagtgtcaggagctctgggatctcggcatccagtgc
atcgacctctttggaattccggaaaagaaaactgaagacggaagtgaatcctacaacgat
aaaggcattattcaggaggcgatccgggctatcaaggcaaaggtacccgatctctgcatc
atgacagacgttgctctcgacccgtttacccctttcggtcacgacggactggtcagggac
ggcatcattctcaacgatgaaaccgttgaagttctctgtaaaatggcggcatctcacgcc
aatgccggagctgatttcgtttcgccaagcgatatgatggacggacgcatcggagccatc
cgggagtcccttgacgatgccggcttttccgatgtcggcattctctcctatgccgccaaa
tatgcatcgagcttctacggacctttccgcgatgcattgcattccgcaccgcagttcggc
gacaagaccacctatcagatgaatcccggcaataccgacgaagccatgaaagaaattgaa
ctcgacatcatggaaggagccgatatcgtcatggtcaagccaggccttgcctatctcgat
atcgtttaccgcaccaaagaacgtttcgatgtgcctgtggctatctatcatgtatcggga
gagtacgccatggtcaaagcggctgccgaaaaaggatggatcgatgaagaacgggtgatg
atggaatcgcttctctgcatgaaacgtgccggcggcgacatgattttcacctattatgca
aaagaagcagcgaaaagactgcgttga

DBGET integrated database retrieval system