KEGG   Chlorobium limicola: Clim_0884Help
Entry
Clim_0884         CDS       T00766                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cli  Chlorobium limicola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Clim_0884
Enzymes [BR:cli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Clim_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
968714..970030
Genome map
AA seq 438 aa AA seqDB search
MKKIGVIGGGISGIATAYFLNKAGFSVDLYEEAPVIGGRIGSECLEGRWLDFGGKNIGRK
YHRFRRFVKEYGDFPFEYFGFNTSQLIDGKVVSLTKESRKLSNFLGFLKLAGLRGGSVLY
PWVRAVMKDNAQGMLRTSFFNDVAEKLDDGSLADCFPSRCAKHLIRPVTVRMNGAEPEEC
YPGNFGSNLALALDSYEQLKGGMHQLLEAFVAAGSGKLSIHAGHRVTALSPCDSGRGVVV
AYTCNGLGGSASYERVISALPATQLSNLIGSSFPDAAEILDRVRYYPVSVAIAVYRDNVF
SKNHRAMVFDSTSPLSNAGAYGIHDLDLVRYTFSGKAAREQIRPESTAEEVISQAEKRVL
PFFCIEGNTRTAMLYKYLSPGLCAYAPFHQRLFSELQNRLASFSGLYVTGDFRRGASIEA
CFAAAEETVQCLMRGEVF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagataggtgtaatcgggggcggtatttcgggtatcgcgacggcttacttcctt
aataaagcaggtttttcggttgacctgtatgaggaagctcctgtaattggcggcagaatc
ggcagcgagtgcctggagggaagatggcttgactttggaggcaagaatatcggcagaaaa
tatcaccggtttcgccgatttgtcaaggaatacggtgatttcccttttgaatattttgga
ttcaacacatcgcaactcattgacggaaaggttgtgagcctcaccaaggagagccggaag
ctgtcaaattttcttggatttctgaaactggccggcctcagaggcgggagcgtgctgtat
ccctgggtgagggccgtgatgaaggacaacgcgcaggggatgcttcgaacctcttttttc
aacgatgtcgcagaaaagctcgatgacggttcgcttgcggactgttttccttcgcgatgc
gcaaaacatctgatccgtcccgtaaccgtgagaatgaacggcgctgaaccggaagagtgc
tatccgggaaatttcggttcgaatcttgctcttgctctcgacagttacgagcagctcaaa
ggaggcatgcatcagcttctcgaagctttcgttgctgccggttccgggaagctatccatt
catgccggtcatcgggtaaccgctctttccccttgcgattcaggacgaggagtggtcgtt
gcctatacctgtaacggcctcggaggatcggcttcctacgagcgggtgatttcggcactt
cctgcaacgcagctttcaaatctgatcggaagctcttttccggatgcggcagagattctc
gatcgtgtcagatactatcctgtctcggttgcgattgcggtatatcgcgacaatgttttc
agcaaaaatcatcgggccatggtattcgacagcacttcccccctcagcaatgccggcgcg
tacggcatacatgaccttgatcttgttcgctatacattcagcggaaaagcggcaagagag
cagatacgccctgaatcgacagcagaagaggttatatcccaggctgaaaaaagagtattg
ccatttttttgtattgaggggaatacacgcaccgctatgctctataagtacctttcgccg
ggtttatgcgcttatgcaccgtttcaccagaggcttttttccgaattgcagaacaggctt
gcctccttttccggcctctacgttacgggtgattttcgtcggggagcctcgatcgaagcg
tgtttcgctgcagccgaagaaaccgtacaatgtctaatgagaggagaagtgttctga

DBGET integrated database retrieval system