KEGG   Chlorobium limicola: Clim_0892Help
Entry
Clim_0892         CDS       T00766                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cli  Chlorobium limicola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cli00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(977210..977947)
Genome map
AA seq 245 aa AA seqDB search
MSTVLVTRPKHQAHSFVNELEQYGLISTVFPTIEIRPVPGWQVPDLSLFRGVFFTSPNSV
QFFMERLLAEAPAELNKLRKMRVWAVGKTTAKDLAVHGIETEPVPKIADAVTLMAEIDYE
VISNNDFLFLRGSLSLGTIPAVIAQRGGRCTEITVYENIKPSVEDSALIKQMLETGGFSC
LSFTSPSTAINFFEAIGTTKIPDGVLIAAIGTTTAAALEKLGVRVDVIPPYFDGPNFAKA
IAEAL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgttcttgttacccgtccaaaacatcaggcgcactcctttgtcaatgagctg
gaacaatatggcctgatctcgactgtctttccgacaatcgagatcaggccggttcccggc
tggcaggtccccgatctttccctttttcgaggcgtatttttcaccagtcccaacagtgtt
cagtttttcatggaacgcctgcttgctgaagcaccggcagagctgaacaaacttcgcaaa
atgagggtgtgggctgtcggaaaaaccacggcaaaagatcttgccgtccatggcattgaa
accgaaccggtacctaaaattgccgatgctgttaccttgatggctgaaattgattatgag
gtcatcagcaataatgactttctcttcctgagaggcagtttgtcgctcggcaccattccg
gcggtcattgcccaacggggaggcagatgtactgaaatcacggtttatgaaaacatcaag
ccatcggtcgaagattccgctctgattaaacagatgcttgaaaccggcgggttttcctgc
ctttcctttaccagtccgtcaacagccataaatttttttgaggcaatcggcacaacgaaa
attcctgatggagtattgattgctgcaatcggcacaacaaccgctgcagctctcgaaaaa
ctcggcgtcagggttgatgtcatcccgccctatttcgacggaccgaatttcgccaaggct
attgccgaagcgctgtaa

DBGET integrated database retrieval system