KEGG   Chlorobium limicola: Clim_0947Help
Entry
Clim_0947         CDS       T00766                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cli  Chlorobium limicola
Pathway
cli03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clim_0947
Enzymes [BR:cli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Clim_0947
DNA repair and recombination proteins [BR:cli03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Clim_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 AAA_11 Viral_helicase1 Helicase_RecD RsgA_GTPase PIF1 T2SSE NTPase_1 HHH_2 TrwB_AAD_bind AAA_16 PhoH UvrD-helicase AAA_29 DEAD AAA_28 ABC_tran cobW AAA_23 MMR_HSR1 AAA_5 ArgK NACHT SRP54 AAA_22 Pirin AAA DUF2075 ABC_ATPase
Motif
Other DBs
NCBI-ProteinID: ACD90023
JGI: Clim0947
UniProt: B3EIT2
Position
complement(1035843..1038065)
Genome map
AA seq 740 aa AA seqDB search
MATPSSDTENNAERELRQETVTGTVERVTYHNEENGFSVLKIRARGSRDAVTVVGNSPAI
SPGEFITCTGSWQNNRTHGLQFKADGIDIIQPTTADGIEKYLASGMVKGVGSFYAKKLVK
KFGTGVLDILDSNPERLLEIEGIGRKRLELITKSWEEQKAIREIMVFLQSHGVGIARAFR
IYKTYRQDAIKKVSENPYSLSLDIDGIGFLTADTIASKLGIAHDSLIRAEAGVRHVLQEL
ASSGHCAVPKERLVQESAAMLDISAPIVEEAIAVETGKFNLVRETIDGAEIFYLAPLHRA
EEKTAAALAALLRGRTPWKGIDLQKAVVQIAEETGLQLSPSQKEALALVLTNKATVITGG
PGVGKTTLVNAILRVIRKKTTKILLCAPTGRAAKRLSESTGMEAKTIHRLLEFDPNSGGF
KRSSGNPLEADMVVVDETSMVDIVLMSKLLSAVPAKAALLLVGDADQLPSVGPGAVLTDI
IASDAVPVVRLTEIFRQAARSQIIVNAHRINNGEIPRNAEGEELSDFYVVNSQTPENIHA
KLMQMVTERIPARFGFHPVRDIQVLTPMNRGGLGSRALNAELQKALNGSAEPKVSRFGSI
FSPGDKVIQMVNNYDKEVFNGDIGAITAIDTEESELTVDFDKRPVRYEFSELDELALAYA
TSIHKSQGSEYLAVVIPLAMQHFTLLERNLIYTAVTRGKKLVVIIAQPKALALAVTNRKA
DRRMTTLALKLTEAAGNPNP
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaccatcttcagataccgaaaacaacgctgaacgcgaactccggcaggaaacg
gttaccggcaccgttgaacgggtaacctaccataacgaggagaacggattttccgtgctt
aaaatcagggcgagaggcagtcgggatgccgtgacggttgtgggcaacagtccggcaata
tctcccggagagtttataacctgcacgggaagctggcagaacaaccgcacccacggcctg
cagttcaaggccgacgggatcgacatcattcagccgacaacggccgacggcatcgaaaaa
taccttgcatccggcatggtcaagggcgtcgggtcgttctacgcaaaaaaactggtcaag
aaattcggaaccggcgtactcgacatactcgacagcaatcccgaacggctgcttgaaata
gagggcatcgggagaaaaaggctggagctgatcacgaaatcctgggaggagcagaaagcc
atccgggaaatcatggtttttctgcagtcgcacggagtcggtatcgcccgggcgttcagg
atctataaaacctatcgccaggatgccatcaaaaaggtttccgaaaacccctacagcctc
tccctcgatattgacggcatcggctttctcaccgccgacaccatcgcctcgaagctcggc
atagctcacgactcgctcatcagggccgaagccggagtgcgccatgttctgcaggaactg
gcctccagcggccactgcgccgtgcccaaagagcggctggtgcaggaatcggccgccatg
ctcgacatctccgctccgatcgtggaagaagccattgccgtggaaaccggcaagttcaat
ctggtgcgcgaaaccattgacggagcagagatcttttatctcgcgccgctccaccgcgcc
gaagaaaagaccgccgcggcgctcgccgctctcctgcgggggaggacgccatggaaaggg
atcgatctgcaaaaagccgtggtgcagattgccgaagagaccggcctgcaactctcccct
tcccagaaagaggcacttgcgcttgtcctcacgaacaaagccaccgtcattaccggaggc
cccggtgtcggcaaaacgacgctcgtgaacgccattctcagggtcatccgaaaaaaaacc
accaaaatcctgctctgcgcccctaccggccgggcggcaaaacggctctcggaatcgacc
ggtatggaagcgaagaccattcaccgcctgcttgaattcgatcccaacagcggcggcttc
aaacgcagctccggaaacccgctcgaagcggatatggtggtcgtcgacgaaacctcgatg
gtcgatatcgtgctgatgagcaagctcctctctgcggttccggcaaaagccgccctgctg
cttgtgggtgatgccgaccagctcccttccgtgggccctggtgcggtacttaccgacatc
atcgcatccgatgcggttcctgtagtacggctgaccgaaattttccggcaggcggcccgg
tcgcagatcatcgtcaacgcccaccgcatcaacaacggcgaaatcccgcgcaacgccgaa
ggcgaagaactgtcggatttctatgtggtgaactcgcagacacccgaaaatatccatgcc
aagctcatgcagatggtaaccgaacgcatcccggcccgcttcggttttcatccggtgcgc
gacattcaggtgctcaccccgatgaaccggggcgggctcggttcgcgtgccctgaacgcc
gaactgcagaaagcgctcaacggcagcgccgagccgaaagtatcgcgcttcggctccatc
ttttcgccgggcgacaaggttatccagatggtcaacaactacgacaaggaggtcttcaac
ggcgacatcggcgccataacggcaatcgacaccgaagagagcgagctgacggtcgatttc
gacaaacggcccgtacgctacgagttcagcgaactcgatgaactcgcgctggcctacgcc
acaagcattcacaaaagccagggctccgaatatctcgccgtcgtcattccgctcgccatg
cagcactttacgctgctcgagcggaacctgatttacaccgccgtcacgcggggaaaaaag
cttgtggtcatcattgcgcagccaaaggccctcgctcttgcagtaacaaacagaaaagcc
gaccgccgcatgaccacgctcgcccttaaactgacggaagccgcaggaaacccgaacccc
tga

DBGET integrated database retrieval system