KEGG   Chlorobium limicola: Clim_0947Help
Entry
Clim_0947         CDS       T00766                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cli  Chlorobium limicola
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cli03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1035843..1038065)
Genome map
AA seq 740 aa AA seqDB search
MATPSSDTENNAERELRQETVTGTVERVTYHNEENGFSVLKIRARGSRDAVTVVGNSPAI
SPGEFITCTGSWQNNRTHGLQFKADGIDIIQPTTADGIEKYLASGMVKGVGSFYAKKLVK
KFGTGVLDILDSNPERLLEIEGIGRKRLELITKSWEEQKAIREIMVFLQSHGVGIARAFR
IYKTYRQDAIKKVSENPYSLSLDIDGIGFLTADTIASKLGIAHDSLIRAEAGVRHVLQEL
ASSGHCAVPKERLVQESAAMLDISAPIVEEAIAVETGKFNLVRETIDGAEIFYLAPLHRA
EEKTAAALAALLRGRTPWKGIDLQKAVVQIAEETGLQLSPSQKEALALVLTNKATVITGG
PGVGKTTLVNAILRVIRKKTTKILLCAPTGRAAKRLSESTGMEAKTIHRLLEFDPNSGGF
KRSSGNPLEADMVVVDETSMVDIVLMSKLLSAVPAKAALLLVGDADQLPSVGPGAVLTDI
IASDAVPVVRLTEIFRQAARSQIIVNAHRINNGEIPRNAEGEELSDFYVVNSQTPENIHA
KLMQMVTERIPARFGFHPVRDIQVLTPMNRGGLGSRALNAELQKALNGSAEPKVSRFGSI
FSPGDKVIQMVNNYDKEVFNGDIGAITAIDTEESELTVDFDKRPVRYEFSELDELALAYA
TSIHKSQGSEYLAVVIPLAMQHFTLLERNLIYTAVTRGKKLVVIIAQPKALALAVTNRKA
DRRMTTLALKLTEAAGNPNP
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaccatcttcagataccgaaaacaacgctgaacgcgaactccggcaggaaacg
gttaccggcaccgttgaacgggtaacctaccataacgaggagaacggattttccgtgctt
aaaatcagggcgagaggcagtcgggatgccgtgacggttgtgggcaacagtccggcaata
tctcccggagagtttataacctgcacgggaagctggcagaacaaccgcacccacggcctg
cagttcaaggccgacgggatcgacatcattcagccgacaacggccgacggcatcgaaaaa
taccttgcatccggcatggtcaagggcgtcgggtcgttctacgcaaaaaaactggtcaag
aaattcggaaccggcgtactcgacatactcgacagcaatcccgaacggctgcttgaaata
gagggcatcgggagaaaaaggctggagctgatcacgaaatcctgggaggagcagaaagcc
atccgggaaatcatggtttttctgcagtcgcacggagtcggtatcgcccgggcgttcagg
atctataaaacctatcgccaggatgccatcaaaaaggtttccgaaaacccctacagcctc
tccctcgatattgacggcatcggctttctcaccgccgacaccatcgcctcgaagctcggc
atagctcacgactcgctcatcagggccgaagccggagtgcgccatgttctgcaggaactg
gcctccagcggccactgcgccgtgcccaaagagcggctggtgcaggaatcggccgccatg
ctcgacatctccgctccgatcgtggaagaagccattgccgtggaaaccggcaagttcaat
ctggtgcgcgaaaccattgacggagcagagatcttttatctcgcgccgctccaccgcgcc
gaagaaaagaccgccgcggcgctcgccgctctcctgcgggggaggacgccatggaaaggg
atcgatctgcaaaaagccgtggtgcagattgccgaagagaccggcctgcaactctcccct
tcccagaaagaggcacttgcgcttgtcctcacgaacaaagccaccgtcattaccggaggc
cccggtgtcggcaaaacgacgctcgtgaacgccattctcagggtcatccgaaaaaaaacc
accaaaatcctgctctgcgcccctaccggccgggcggcaaaacggctctcggaatcgacc
ggtatggaagcgaagaccattcaccgcctgcttgaattcgatcccaacagcggcggcttc
aaacgcagctccggaaacccgctcgaagcggatatggtggtcgtcgacgaaacctcgatg
gtcgatatcgtgctgatgagcaagctcctctctgcggttccggcaaaagccgccctgctg
cttgtgggtgatgccgaccagctcccttccgtgggccctggtgcggtacttaccgacatc
atcgcatccgatgcggttcctgtagtacggctgaccgaaattttccggcaggcggcccgg
tcgcagatcatcgtcaacgcccaccgcatcaacaacggcgaaatcccgcgcaacgccgaa
ggcgaagaactgtcggatttctatgtggtgaactcgcagacacccgaaaatatccatgcc
aagctcatgcagatggtaaccgaacgcatcccggcccgcttcggttttcatccggtgcgc
gacattcaggtgctcaccccgatgaaccggggcgggctcggttcgcgtgccctgaacgcc
gaactgcagaaagcgctcaacggcagcgccgagccgaaagtatcgcgcttcggctccatc
ttttcgccgggcgacaaggttatccagatggtcaacaactacgacaaggaggtcttcaac
ggcgacatcggcgccataacggcaatcgacaccgaagagagcgagctgacggtcgatttc
gacaaacggcccgtacgctacgagttcagcgaactcgatgaactcgcgctggcctacgcc
acaagcattcacaaaagccagggctccgaatatctcgccgtcgtcattccgctcgccatg
cagcactttacgctgctcgagcggaacctgatttacaccgccgtcacgcggggaaaaaag
cttgtggtcatcattgcgcagccaaaggccctcgctcttgcagtaacaaacagaaaagcc
gaccgccgcatgaccacgctcgcccttaaactgacggaagccgcaggaaacccgaacccc
tga

DBGET integrated database retrieval system