KEGG   Chlorobium limicola: Clim_1232Help
Entry
Clim_1232         CDS       T00766                                 

Definition
ATP-grasp domain-containing protein
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
cli  Chlorobium limicola
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clim_1232
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Clim_1232
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Clim_1232
Enzymes [BR:cli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Clim_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1330333..1331529)
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVIMDPNRLEQLGEANKWLRESKLVVKAHEAIGGRFK
LGLVKLGLNLEEAVAASREMIGREIGTAVIRQVIVAEMLDHDEEYYLCINGNRDGAEVLL
SNRGGVDIEENWDTVRRLFIPIDENPSVERLTEFAAEAGFTGEIAERVGKIVSRLVLCFD
NEDAQSIEINPLVIRKSDMRFAALDAVMNVDYDARFRHADWDFKPVSEIGRPFTEAELQI
MEIDARIKGSVKFVEVPGGEIALLTAGGGASVFYSDAVVARGGTIANYAEYSGDPSDWAV
EALTETVCALPNIKHIIVGGAIANFTDVKATFNGIINGFRESKSKGYLENVKIWVRRGGP
NENQGLAAIRKLQDEGFDIHVYDRSMPMTDIVDLALNS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatacttgaagggccggctatgaagctatttaacaagtggggcatacctgtg
ccaaactatgtagttatcatggacccgaaccggcttgaacaacttggtgaagctaataaa
tggctgagagaatcaaaacttgttgtcaaagctcatgaggctatcggcggccgtttcaag
ctcggtcttgtaaagctcggcctgaatcttgaagaggcggtagcagcttcacgcgagatg
atcggacgcgagatcggcacggccgtcatccgccaggtcattgtcgcagagatgctcgac
cacgatgaagagtactacctctgcatcaacggcaaccgtgacggtgcggaagtgctgctc
tccaacaggggaggtgtcgatatcgaggagaactgggacacggttcgccgtctcttcatt
cctatcgacgagaacccttccgtcgaacgactcacggaatttgccgccgaagccggattc
accggtgaaattgcagaacgggtaggtaaaatagtttcacgccttgtcctctgtttcgac
aatgaagacgcacaatcaatagagatcaatccgctcgttatccgcaaaagcgacatgcgc
tttgccgcacttgacgcggtcatgaatgtggattacgacgcccgcttccgccatgccgac
tgggatttcaagccggtttcggaaatcggacgtcccttcaccgaagcagaactgcagatc
atggaaatagatgcacgcatcaagggttccgtcaagttcgtagaggttcccggcggtgaa
atagctcttcttactgcaggcggcggcgcctcggtattctactcggatgctgttgtggcc
agaggtggcaccattgccaactatgcagaatattccggagatccgtcggattgggcggtc
gaagccctgacggaaaccgtatgtgcccttccgaacatcaagcatatcatcgtcggcggc
gccattgcaaacttcaccgatgtaaaggcaaccttcaacggcattatcaacggattccgt
gaaagcaaatcgaaaggctatctcgaaaatgtaaaaatctgggtcagacgcggtggaccg
aatgaaaatcagggccttgccgcaatcagaaaactgcaggacgagggctttgacatccat
gtgtacgaccgcagtatgccgatgaccgatattgttgaccttgcactgaattcataa

DBGET integrated database retrieval system