KEGG   Chlorobium limicola: Clim_1232Help
Entry
Clim_1232         CDS       T00766                                 

Definition
(GenBank) ATP-grasp domain protein
  KO
K15231  ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
cli  Chlorobium limicola
Pathway
cli00020  Citrate cycle (TCA cycle)
cli00720  Carbon fixation pathways in prokaryotes
cli01100  Metabolic pathways
cli01110  Biosynthesis of secondary metabolites
cli01120  Microbial metabolism in diverse environments
cli01130  Biosynthesis of antibiotics
cli01200  Carbon metabolism
Module
cli_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
cli_M00614  Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Clim_1232
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Clim_1232
Enzymes [BR:cli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Clim_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_bind ATP-grasp_2 ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACD90299
JGI: Clim1232
UniProt: B3ECM4
Position
complement(1330333..1331529)
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVIMDPNRLEQLGEANKWLRESKLVVKAHEAIGGRFK
LGLVKLGLNLEEAVAASREMIGREIGTAVIRQVIVAEMLDHDEEYYLCINGNRDGAEVLL
SNRGGVDIEENWDTVRRLFIPIDENPSVERLTEFAAEAGFTGEIAERVGKIVSRLVLCFD
NEDAQSIEINPLVIRKSDMRFAALDAVMNVDYDARFRHADWDFKPVSEIGRPFTEAELQI
MEIDARIKGSVKFVEVPGGEIALLTAGGGASVFYSDAVVARGGTIANYAEYSGDPSDWAV
EALTETVCALPNIKHIIVGGAIANFTDVKATFNGIINGFRESKSKGYLENVKIWVRRGGP
NENQGLAAIRKLQDEGFDIHVYDRSMPMTDIVDLALNS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatacttgaagggccggctatgaagctatttaacaagtggggcatacctgtg
ccaaactatgtagttatcatggacccgaaccggcttgaacaacttggtgaagctaataaa
tggctgagagaatcaaaacttgttgtcaaagctcatgaggctatcggcggccgtttcaag
ctcggtcttgtaaagctcggcctgaatcttgaagaggcggtagcagcttcacgcgagatg
atcggacgcgagatcggcacggccgtcatccgccaggtcattgtcgcagagatgctcgac
cacgatgaagagtactacctctgcatcaacggcaaccgtgacggtgcggaagtgctgctc
tccaacaggggaggtgtcgatatcgaggagaactgggacacggttcgccgtctcttcatt
cctatcgacgagaacccttccgtcgaacgactcacggaatttgccgccgaagccggattc
accggtgaaattgcagaacgggtaggtaaaatagtttcacgccttgtcctctgtttcgac
aatgaagacgcacaatcaatagagatcaatccgctcgttatccgcaaaagcgacatgcgc
tttgccgcacttgacgcggtcatgaatgtggattacgacgcccgcttccgccatgccgac
tgggatttcaagccggtttcggaaatcggacgtcccttcaccgaagcagaactgcagatc
atggaaatagatgcacgcatcaagggttccgtcaagttcgtagaggttcccggcggtgaa
atagctcttcttactgcaggcggcggcgcctcggtattctactcggatgctgttgtggcc
agaggtggcaccattgccaactatgcagaatattccggagatccgtcggattgggcggtc
gaagccctgacggaaaccgtatgtgcccttccgaacatcaagcatatcatcgtcggcggc
gccattgcaaacttcaccgatgtaaaggcaaccttcaacggcattatcaacggattccgt
gaaagcaaatcgaaaggctatctcgaaaatgtaaaaatctgggtcagacgcggtggaccg
aatgaaaatcagggccttgccgcaatcagaaaactgcaggacgagggctttgacatccat
gtgtacgaccgcagtatgccgatgaccgatattgttgaccttgcactgaattcataa

DBGET integrated database retrieval system