KEGG   Chlorobium limicola: Clim_1378Help
Entry
Clim_1378         CDS       T00766                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cli  Chlorobium limicola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clim_1378
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Clim_1378
  Amino acid metabolism
   00310 Lysine degradation
    Clim_1378
Enzymes [BR:cli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Clim_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1483941..1485188
Genome map
AA seq 415 aa AA seqDB search
MAIIDVTISQLSESVSEATLLNWKKQPGDAVAEDEILFEVETDKVVFDVPSPSSGILFEI
LVGDGGTIVPGQVLARIDSEGTPAAAPSAPVEEPDSETGTTVHPSEPQSQATSPFAMPSA
ARLMAESGLDAREVHGTGKQGRIIKGDVLAAIAAGAEPATPVSASTQKILPVEAYRELPV
ATDRPEQRVPMTRLRARIAERLLQSQSTNAILTTFNEVNMQPVIDLRNRYREAFEKEHGV
KLGFMSFFVKAVVHALRKYPVLNASVDGKDIIYHGYFDIGVAVSSPRGLVVPVLRNADQM
SIAEIERKITDFSTKARLGTLSLEELSGGTFSVSNGGVFGSMLSTPIINPPQSAILGIHA
TKERPVVENGEIVIRPMNYLAMSYDHRIIDGKEAVLGLVAIKNALEDPARLLLDL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcaataatcgatgtcaccatatcccagttgtcggaatcggtttccgaagcgactctg
ctgaactggaaaaaacagccaggagatgccgttgccgaagatgaaattctgttcgaagtc
gaaacagacaaagtggtattcgatgtcccgtcaccatcatccggaattctctttgaaatt
cttgtcggagacggaggaacaatcgttcccggacaggtacttgcgagaatcgacagcgaa
ggtaccccggcggcagctccatcggcacccgttgaagaaccggattccgaaacaggaaca
accgtgcatccttcggaaccccaatctcaggcaacaagccccttcgccatgccatcggca
gcccgcctcatggcggaaagcggattggatgcccgggaggtgcatggcacaggaaaacag
ggaagaatcatcaagggcgacgttctggccgcaattgcagccggagcggaaccagccacg
ccggtatcggcttcgacacagaaaatcctgcctgtcgaggcataccgggaactacccgtg
gcaaccgaccgccccgaacagcgcgtaccgatgacccggctcagggcacgcattgccgaa
aggctcctgcaatcccagtccacgaacgccattctcacgaccttcaacgaagtcaacatg
cagccggtcatcgatctgcggaaccgttacagggaagcgttcgaaaaagaacacggcgtc
aaactcggattcatgtcattcttcgtaaaggctgtggtgcatgccctgaggaagtatccg
gtactgaacgcatcggttgacggcaaggatatcatctatcacggctatttcgacatcggg
gtcgcggtcagctctccaagaggccttgtcgttcctgtcctgcgcaacgccgaccagatg
agcatagctgaaatcgaacggaaaatcacagacttctccacgaaagccaggctcggaacg
ctttcgctcgaagaactgagcggaggtaccttctctgtttcaaacggcggcgtgttcgga
tcgatgctctcgacacccatcatcaacccgccccaatcggcgattctcggcatccatgca
accaaagaaaggcctgttgttgaaaacggagaaatcgtgatccgtccgatgaactacctt
gccatgtcctacgaccaccgtattatcgacggcaaggaagccgtcctcggccttgttgca
atcaagaatgcgctggaagaccctgcgcgtctcctcctcgatctttaa

DBGET integrated database retrieval system