KEGG   Chlorobium limicola: Clim_1468Help
Entry
Clim_1468         CDS       T00766                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
cli  Chlorobium limicola
Brite
Enzymes [BR:cli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Clim_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1573849..1576926)
Genome map
AA seq 1025 aa AA seqDB search
MSNPFFDHPILNSPYRYPERHWELDEHGQPTQKIIDTRRPAQFITPIPKPRKRRSDEAQQ
QLVFDEGKGLSTETQQYDQTSLINAVRREVEKWRELPNPNNWQVTPETARLLQHWRHHDF
SGIRPFFCQVEAVETAIWLTEVAPHTGKTGKRFLDHLEDANGNANPEIMRLALKLATGAG
KTTVMAMLIAWQAVNAARRPQSRKFTRGFLVVTPGITIRDRLRVLLPNDPDSYYKSRELV
PGDMIGDIERAKIVITNYHAFKLRERHELSKGGRLLLQGRGQKLQTLETEGQMLQRVMPY
LMGMKNIMVINDEAHHCYREKPDGDEFQELRGDEKKEAEENNEAARVWITGIETVKRKLG
VNWVIDLSATPFFLSGSGYAEGTLFPWTMSDFSLMDAIESGIVKLPRVPVADNVPGGDMP
KFRELWKHIGKKMPKKSRSKTNAYDPLSIPVELQTALEALYGHYRQTFDLWKENNISVPP
CFIVVCNNTSTSKLVHDYISGFYREQEDGTKQLVNGRLELFRNFDADGSPLPQPSTLLID
SKQLESGDALDRNFRDMAGDEIERFRREIIERTGDRRQAENLTDQDLLREVMNTVGKHGR
LGQSIRCVVSVSMLTEGWDANTVTHVLGVRAFGTQLLCEQVIGRALRRQSYDLNEECLFN
TEYADVLGIPFDFTAKPVVAPPQPPRETVQVRAVRPERDHLEITFPNVAGYRVELPEEQL
TAEFTDESVLELTPDLVGPSITRNSGIIGEAIDLSLEHLGDMRQSTLLFHLTQRLLYTKW
RDPEESPKLHLFGQLKRITRQWLDTCLVCKGGTYPAQLIYQELADIACNRITAAITRAEI
GRRPVKAVLDPYNPTGSSRYVNFTTSKRDRWETDARHCHVNWVILDSDWEAEFCRVAESH
PKVRSYVKNHNLGLEVPYRYGSEMRRYLPDFIVLIDDGNGSDDLLHLVVEIKGYRREDAK
EKKSTMDTYWITGVNNIGTYGRWAFAELTQPYTFELDMGKQIEEAFSRMLEQASAVQSEG
ATSHA
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcctttcttcgatcatcccatactcaactctccctacaggtatcccgaacgg
cactgggaactcgacgaacacggccagcctacccagaaaatcatcgacactcgacgaccg
gcgcagttcatcacgccgattccgaaaccccgcaaacgcaggagtgacgaagcccagcag
cagcttgttttcgacgaaggaaaaggcctttcaaccgaaacccagcagtacgaccagaca
tcgcttatcaacgccgtccgccgtgaggttgagaagtggcgggaattgccgaacccgaac
aactggcaggtaacgcctgaaaccgcccggctgctgcagcactggcggcaccacgacttc
agcggtatccgtccctttttctgtcaggtggaagcggtagaaaccgccatctggctgacc
gaggttgcaccccatacgggaaaaacgggcaagaggtttctcgaccatctcgaagacgcc
aatggcaatgccaacccggaaatcatgcgccttgcactgaagcttgcaaccggagccggc
aaaaccaccgttatggccatgctcattgcgtggcaggcggtcaatgccgcccgcaggccg
caaagccggaagttcacgcgaggctttctcgttgtcacgccaggcatcaccattcgcgac
cggctcagggttttgctgcccaacgaccccgacagctattacaaaagccgcgaacttgta
cccggcgacatgatcggtgatatcgaacgggccaagatcgtcatcaccaactaccacgct
ttcaagcttcgtgaacggcacgaactctccaaaggcgggcgattgctcctgcagggcagg
ggacaaaagctgcagaccctcgaaaccgaagggcagatgctgcagcgggttatgccgtac
ctgatgggtatgaagaacatcatggtcatcaacgatgaggcacaccactgttaccgcgaa
aaaccggatggtgatgaattccaggaactcaggggcgacgagaaaaaggaagccgaagag
aacaatgaagcggcgcgggtctggattaccggcatcgaaaccgtgaaaagaaagcttggc
gtgaactgggtgatcgacctgtcggctacgccctttttcctgagcggttccggctatgcc
gagggtacgctgtttccctggaccatgagcgacttttcgctgatggacgccatcgaaagc
ggcatcgtcaaattgccgagggtgccggtagccgacaacgtacccggcggcgacatgccg
aagttccgtgaactctggaagcatatcggcaaaaagatgccgaagaaaagccgcagcaag
acaaacgcctacgacccgctcagtattccggtagagctgcagactgctctcgaagcgctt
tacggccattaccggcagaccttcgacctctggaaagagaacaatatttccgtgccaccc
tgcttcatcgtggtttgcaacaacacctcgacatcgaagctggtgcacgactacatttcc
ggtttttaccgcgagcaggaagacggcacgaagcaactggtcaacgggaggctcgaactt
ttcaggaacttcgatgcggacggttcaccccttccgcaaccgagcacactgcttatcgac
agcaagcagctcgaatccggcgatgcgctcgacaggaacttccgcgacatggccggtgac
gaaatcgaacggttccggagagagatcatcgagcgaaccggcgaccgccgacaggctgaa
aacctcaccgatcaggaccttctgcgcgaggtcatgaacaccgtgggaaagcatggccgg
cttgggcagtcgatccgttgcgtggtgtcggtctccatgcttaccgaagggtgggacgcc
aacacggtcacccatgtgctcggcgtccgcgcattcggcacccagctcctctgcgagcag
gtgatcgggcgcgctctgcgcaggcagtcctacgatctcaacgaagagtgtctcttcaac
accgaatatgccgatgtgctcggcatacccttcgacttcaccgccaagccggttgtcgcc
ccgccgcagccgccgcgcgaaaccgtgcaggtcagggctgtccgtccggaacgcgatcat
cttgaaatcacctttcccaacgtggcgggttatcgtgtcgaactgcctgaagaacagctt
accgccgagtttaccgatgaatcggtgctcgaacttacgcccgaccttgtcggcccctcg
atcacgcgcaactcgggcatcatcggcgaagccatcgacctcagcctcgaacaccttggc
gacatgcgccagtcaaccctgctgttccacctgacccagcggctgctctacaccaaatgg
cgcgacccggaggagtcgcccaagctgcacctcttcggccagctcaagcgcatcacccgc
cagtggctcgacacctgccttgtctgcaaagggggaacctaccctgcgcagctcatctat
caggaacttgccgacattgcctgcaaccgcatcacagcagccatcacgagggcggaaatc
ggcaggcggccggtcaaggccgtgctcgacccttacaatccgacaggttcatcaaggtat
gtgaactttaccacatcgaaacgcgaccgatgggaaaccgatgcacggcactgccatgtc
aactgggtcattctcgacagcgactgggaagccgagttctgcagggttgccgaatcgcat
cccaaggtccgttcatacgtcaagaaccataacctcgggctcgaagtcccttaccggtac
ggctccgaaatgcgccgatacctgccggacttcattgtgctcattgacgacggcaacggc
agtgacgacctcctgcacctcgtggttgaaatcaagggctaccggcgcgaagacgccaag
gagaagaaatccaccatggatacctactggattaccggcgtcaacaacatcggcacttac
gggcgctgggcattcgcggagcttacccagccctacaccttcgaactggatatgggcaag
cagatcgaggaggcgttcagcagaatgctcgaacaggcatcggctgttcaatcagaggga
gcgacgagccatgcttga

DBGET integrated database retrieval system