KEGG   Chlorobium limicola: Clim_1493Help
Entry
Clim_1493         CDS       T00766                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cli  Chlorobium limicola
Pathway
cli00860  Porphyrin and chlorophyll metabolism
cli01100  Metabolic pathways
cli01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Clim_1493
Enzymes [BR:cli01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Clim_1493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_16 Sigma54_activat AAA_22 AAA AAA_33 AAA_29 AAA_18 DUF815 ABC_tran AAA_30 PilO RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ACD90545
JGI: Clim1493
UniProt: B3EDC0
Position
complement(1603976..1605136)
Genome map
AA seq 386 aa AA seqDB search
MTQTETAAKKSAAAKVKAGSDAPATQEPKKAAKPAAKKKSGLAFPFTAIVGQEEMKLSLI
LNIIDPRIGGVLVMGHRGTGKSTTVRALAEVLPFIDRVKDDIYNRTPEQYLEGEDAKKGR
RAIDPESIKTEKIPVPVVDLPLGATEDRVCGTIDIEQALTSGVKAFEPGLLAQANRGFLY
IDEVNLLDDHLVDVLLDVAASGKNVVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRF
GLHARIITILDVAKRVDIVKRRRDFDEDPDAFMKKYNREQQKLQKKIQQAKDLLPQVTMT
DSVLTDIARLCMNLGIDGHRGELTITRTAHAHAAFLGDKEVTMQHVREIAGLCLRHRLRK
DPLETLDAGEKIEREIAKVLGEAEAV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgactcagactgaaacagctgcaaaaaagagtgctgcagccaaagtgaaagcaggttcg
gatgcgccggcaactcaggaaccgaaaaaagcggcaaagccggcagccaaaaagaagtca
ggtcttgcttttcctttcacggccattgtcggtcaggaggaaatgaagctcagtctgatc
ctcaatatcatcgatccgaggatcggaggtgtgctggtcatgggtcacagaggtaccgga
aaaagtactaccgtcagggctcttgctgaagtgcttccgtttatcgacagggtcaaggat
gatatttacaatcggactcccgaacagtaccttgaaggcgaagatgcgaaaaaaggccgc
agggcgatcgatcccgaatccatcaaaaccgagaaaataccggtgcctgtcgtcgatctt
ccgcttggcgctaccgaagatcgcgtttgcggaaccatcgatatcgaacaggctcttacc
agtggtgtaaaagcgttcgagccgggtcttcttgcccaggccaacaggggcttcctctac
atcgacgaggtcaacctgcttgacgatcatcttgttgacgtgctgctcgatgtggccgcc
agcggcaagaacgtcgtcgagcgcgaaggcatcagcattcgccaccccgcccgcttcgtg
cttgtcggttccggcaacccggaagaaggtgagcttcgtccccagctgctcgaccgtttc
ggtctgcacgcccgtatcatcaccattctcgatgtcgccaagcgtgtcgatatcgtcaag
cgtcgccgcgatttcgatgaagatccggacgctttcatgaagaaatacaatcgtgagcag
cagaagcttcagaaaaagattcagcaggcaaaagatctgcttccccaggtaaccatgacc
gacagcgtactgaccgatatcgccagactctgtatgaacctcggtatcgacggtcaccgc
ggagaacttaccattacccgtaccgcacatgcccacgcggcatttctgggcgacaaggaa
gtgaccatgcagcatgtcagagagatagcaggcctttgcctgcgccatcgcctgcgcaag
gatccgcttgaaactctcgatgccggtgaaaaaattgaacgtgaaatcgcaaaagtcctt
ggagaagcagaagcagtataa

DBGET integrated database retrieval system