KEGG   Chlorobium limicola: Clim_1670Help
Entry
Clim_1670         CDS       T00766                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cli  Chlorobium limicola
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clim_1670 (tpiA)
   01230 Biosynthesis of amino acids
    Clim_1670 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clim_1670 (tpiA)
   00051 Fructose and mannose metabolism
    Clim_1670 (tpiA)
   00562 Inositol phosphate metabolism
    Clim_1670 (tpiA)
Enzymes [BR:cli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Clim_1670 (tpiA)
Exosome [BR:cli04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Clim_1670 (tpiA)
  Exosomal proteins of bladder cancer cells
   Clim_1670 (tpiA)
  Exosomal proteins of melanoma cells
   Clim_1670 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1837052..1837807)
Genome map
AA seq 251 aa AA seqDB search
MKRTNIVAGNWKMNLTIAESVELASAVIAELGSGFSGCEAGIAPTCPALFETGKLLASGS
LFLAAQNCHYENDGAFTGEVSARMILGAGCTYVIIGHSERRQLFGETDEIVNRKVSKALQ
EGLRVILCVGETLEEREGGITGDVVTRQVKAGLAGIAGIGDLVIAYEPVWAIGTGKTASS
EQAQEVHALIRKTVSELYGAEAADGLRIQYGGSVKPSNAAELFAMPDIDGGLIGGASLNA
ADFAAIVKAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtacaaacattgttgcaggtaactggaaaatgaatttgaccattgccgagtcc
gtggagcttgcttctgcggttatcgcagagcttggcagcggtttttcagggtgtgaagcc
ggcatcgctccaacctgtcccgctcttttcgagaccggaaaattactcgcatcgggttct
ctttttcttgccgcacaaaactgccactacgaaaacgatggcgcctttaccggagaggta
tctgcaaggatgattctcggtgccggctgcacttacgttattatcggtcattccgagcgt
cgtcagcttttcggtgagacggatgaaatcgtcaaccgcaaggtctccaaagcgcttcag
gaagggctcagggtcattctctgtgtcggcgaaacgctcgaagagcgagaaggcggtatt
accggcgatgtggtgacccgtcaggtcaaggcaggtcttgccggcattgccggcatcggt
gatctggtgatcgcgtatgagccggtatgggccatcggtacaggcaaaacagcctcttcc
gagcaggcgcaggaagtgcatgctcttattcgcaagacggtcagtgagctttatggagca
gaggctgccgacggtcttcgtatccagtacggaggaagcgtgaagccttcgaacgctgcg
gaactgtttgccatgccggacatcgacggcgggcttatcggcggtgcgagcctcaatgca
gcggattttgccgctatcgtcaaggctgcctgctga

DBGET integrated database retrieval system