KEGG   Chlorobium limicola: Clim_1700Help
Entry
Clim_1700         CDS       T00766                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cli  Chlorobium limicola
Pathway
cli00900  Terpenoid backbone biosynthesis
cli01100  Metabolic pathways
cli01110  Biosynthesis of secondary metabolites
cli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Clim_1700
Enzymes [BR:cli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Clim_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACD90742
JGI: Clim1700
UniProt: B3EE40
Position
complement(1869454..1870320)
Genome map
AA seq 288 aa AA seqDB search
MLPVSVKSFAKINLGLLITSKRSDGYHTLETVFAPIDWYDTLEFSPSDTLSMCCTDSALP
VDENNLCMRAAKALQESAGCSTGVSITLDKRIPFGAGLGGGSSDAATVLGMLNEFWNVRA
SLADLHILAVRLGADVPYFLEMKGLAFAKGIGDELEDLSLRLPFHIVTVFPEVHISTVWA
YKHFYPRFERTSPDLRPLVTALCLEGERSCLGAFENDFEPAVFDHYPGVKKVKQDLLDSG
SFFASLSGSGSAVFGFFDKREDADDALMMMREQGFRTSITAPDFSMVR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctgtttctgttaaatcttttgcaaagatcaatctcggtcttctgatcacgtca
aaaaggtctgatggatatcatacacttgaaacggtattcgctccgatcgactggtatgat
acccttgagttttcgccttccgatacgctttcgatgtgctgtacggactccgctctgcct
gtcgatgagaacaatctctgcatgcgcgcggcaaaagctttacaggaatctgcaggttgt
tccaccggcgtttccataacgctggacaagcgcatccctttcggggcaggtctgggaggc
ggcagcagtgacgctgcgaccgtgctcggcatgctcaatgaattctggaatgtacgcgcc
tctcttgccgatctgcatatccttgctgtccggcttggtgcggatgtcccatattttctc
gaaatgaaggggctggcgtttgcgaaggggatcggggatgagcttgaggatctttccctg
aggttgccgtttcatatcgtaacggtgtttcctgaagtgcatatatcaaccgtttgggcc
tataaacatttctatccccggttcgaacgtacctcccccgatctgagaccgctcgttacg
gccctctgtcttgagggtgaacgatcatgcctcggtgcttttgaaaatgatttcgagccg
gcggtgtttgatcattatcccggggtgaaaaaggtcaagcaggatttgctcgattcaggc
agttttttcgcgtcgctttcaggcagtggttctgcagtgttcggctttttcgacaagcgt
gaagatgcggacgatgcactcatgatgatgcgggagcagggcttccgtacaagcatcact
gcaccggacttttcaatggtgcggtga

DBGET integrated database retrieval system