KEGG   Chlorobium limicola: Clim_2184Help
Entry
Clim_2184         CDS       T00766                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cli  Chlorobium limicola
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clim_2184
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clim_2184
   00052 Galactose metabolism
    Clim_2184
   00500 Starch and sucrose metabolism
    Clim_2184
   00520 Amino sugar and nucleotide sugar metabolism
    Clim_2184
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Clim_2184
   00524 Butirosin and neomycin biosynthesis
    Clim_2184
Enzymes [BR:cli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Clim_2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2422516..2423502)
Genome map
AA seq 328 aa AA seqDB search
MSQWAIGIDLGGTAVKAAIVSRKKGILKNRTVPTDTASGPEGIVSQLAVMIASLYTEASA
ELSRQDFSGIGFGAPGAVDIEAGTLSYPPNLPGWTTFPLRSELERALLAKLPKSVPVVIE
NDANAAAYGEAVYGAGRNFRDFLMVTLGTGVGGGIVLNRKLYRGPNGTAGEIGFMIVDFQ
SPAVHAGIHGTIEGMIGKERIVEYACGLIRDNPEAGSLLASLCGQDFSSLSPRHIEQAAK
MGDQLSLAVWNHVGAILGTGFACVTSLMDIRKFVIGGGISAAGTLIFEPAYRQLLRSTLP
SMHDGLELVPAELGNSAGIYGAAALCFS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatgggcaattggtattgatctcggtggtacggctgtcaaagcggcaatcgtg
agccgtaaaaaaggaattctcaaaaacaggacggtacctaccgataccgcttccggcccg
gaggggattgtatcgcagcttgccgttatgatcgcttcgctttacaccgaagcctctgca
gagctttcccgtcaagacttttcaggtatcggtttcggagctccgggagctgttgatatt
gaagccggaacgctgagctatccgcccaatcttcccggatggaccacctttcccctgcgc
agcgagcttgagcgcgccctgctggccaaactgccgaagtctgtaccggtggtcatcgag
aacgacgccaatgctgcggcttacggtgaagcggtctatggcgccggccgtaattttcgg
gattttttgatggtgacactcggcaccggagtaggcggcggcatcgttctgaaccgtaaa
ctgtaccgggggccgaacggaacggccggtgaaataggatttatgattgtcgattttcag
agtccggctgtgcatgccggtattcacggcaccatagaagggatgatcggcaaagagcgc
attgtcgaatatgcatgcggccttattcgtgacaaccctgaagccggctcgttgcttgcg
tctctctgtggccaggatttttcatcgctctctccccgtcatatcgagcaggcggcaaaa
atgggcgatcagctctctcttgcggtatggaaccatgtcggggcaattctcggaacgggg
ttcgcttgcgttacctcgctcatggatatacgaaaattcgttatcgggggggggatatcg
gcagccggcactcttattttcgaaccggcttaccggcagttgctccgctctaccctgcct
tcgatgcatgacgggctcgaactggttccggccgaactcggcaacagtgcgggaatatat
ggcgcggcggcgttgtgtttcagttga

DBGET integrated database retrieval system