KEGG   Chlorobium limicola: Clim_2334Help
Entry
Clim_2334         CDS       T00766                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cli  Chlorobium limicola
Pathway
cli00260  Glycine, serine and threonine metabolism
cli00750  Vitamin B6 metabolism
cli01100  Metabolic pathways
cli01110  Biosynthesis of secondary metabolites
cli01120  Microbial metabolism in diverse environments
cli01230  Biosynthesis of amino acids
Module
cli_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clim_2334
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Clim_2334
Enzymes [BR:cli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Clim_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACD91357
JGI: Clim2334
UniProt: B3EHU8
Position
2565730..2567043
Genome map
AA seq 437 aa AA seqDB search
MIYFSTNKSSTPVSIKKATLEGLAPDGGLYVPSEIPVFSAPEMQLLEDGSFNNIAFAIAR
KFICGEIPPDQLSDIIDSCYPFETPLVELEKGTFIEELFSGPTLAFKDYGARFLARLTGY
FASEERKLITVLVATSGDTGSAVAYGFQGIQNTRVVLLYPSGKVSRLQEQQLTTAGGNVQ
ALEVQGDFDDCQRLVKQAFTDPELKERLTLTSANSINISRLIPQSFYYAWATLHLKAQYG
LEQPVFSVPSGNYGNLTAGVLARMMGFPIGHFIAASNANDSVTRYLDEGRYDPHPTIPTL
STAMDVGNPSNFARLRHFYGNDHHAMGKDITGIAISDDATVATIRDIFRRYGYVIDPHTA
VGFRALEEYRQTSGSRSPGIVLSTAHPAKFLEVIEDALEKEIEIPERLSVVLEKKKQAAM
IGTDYRELADFLKHLER
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatctatttcagtacgaataaatcttccactccggtctctataaaaaaagccaccctc
gagggacttgcccctgacggcggactctatgtcccatcggaaataccggttttttcagct
cctgagatgcagctgcttgaagacggaagtttcaacaatatcgcatttgccatagcaagg
aaattcatctgcggggagatcccgcccgatcagctcagcgacattatcgacagctgctat
ccgtttgaaaccccgcttgtcgaactggaaaaaggaacctttatcgaggagctgttttct
ggaccgactctggccttcaaggattacggcgcaaggtttctggccaggcttaccggctac
ttcgcatcggaggagcggaagctcatcacggttcttgtcgctacttccggcgataccggc
agtgctgttgcctatggatttcagggaattcagaacaccagggtagtgctgctctacccc
tccggaaaagtaagccgcctgcaggaacagcagctaaccaccgcagggggcaatgtacag
gctctggaagtgcagggcgacttcgacgactgccagcggctggtcaagcaggcgtttacc
gatccggaactgaaggaacggcttaccctgacctcggcaaactccatcaacatatcacgg
ctgattccgcagtcattctattatgcctgggcaacgctgcatctgaaagctcaatacgga
cttgaacagccggtattctcggtaccaagcggaaactatggcaaccttactgcaggcgtt
cttgcccggatgatgggctttcctatcggccacttcatcgcggcatcgaacgccaacgac
agcgtcacccgctatcttgacgagggccgttacgacccccatccgacgatcccgacactt
tctacagccatggatgtcggcaatccgagcaactttgcccggctccggcacttttacgga
aacgaccaccatgccatgggtaaggacatcacgggtatcgcgatttccgatgatgctacc
gtcgctacaatccgcgatattttcaggcgttacggctatgttatcgatccgcacaccgcc
gtaggattccgggcactcgaagagtaccgtcagacaagcgggagccgctcgccgggaata
gttctgtcaacggctcatccggcaaaattcctcgaagtcatcgaggatgcgctggaaaaa
gagatcgaaattccggaacgcctttcggtggtgctcgaaaagaaaaaacaggccgccatg
atcggcaccgattacagagaactcgccgacttccttaaacatctggaacgataa

DBGET integrated database retrieval system