KEGG   Chlorobium limicola: Clim_2334Help
Entry
Clim_2334         CDS       T00766                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cli  Chlorobium limicola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clim_2334
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clim_2334
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Clim_2334
Enzymes [BR:cli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Clim_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2565730..2567043
Genome map
AA seq 437 aa AA seqDB search
MIYFSTNKSSTPVSIKKATLEGLAPDGGLYVPSEIPVFSAPEMQLLEDGSFNNIAFAIAR
KFICGEIPPDQLSDIIDSCYPFETPLVELEKGTFIEELFSGPTLAFKDYGARFLARLTGY
FASEERKLITVLVATSGDTGSAVAYGFQGIQNTRVVLLYPSGKVSRLQEQQLTTAGGNVQ
ALEVQGDFDDCQRLVKQAFTDPELKERLTLTSANSINISRLIPQSFYYAWATLHLKAQYG
LEQPVFSVPSGNYGNLTAGVLARMMGFPIGHFIAASNANDSVTRYLDEGRYDPHPTIPTL
STAMDVGNPSNFARLRHFYGNDHHAMGKDITGIAISDDATVATIRDIFRRYGYVIDPHTA
VGFRALEEYRQTSGSRSPGIVLSTAHPAKFLEVIEDALEKEIEIPERLSVVLEKKKQAAM
IGTDYRELADFLKHLER
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatctatttcagtacgaataaatcttccactccggtctctataaaaaaagccaccctc
gagggacttgcccctgacggcggactctatgtcccatcggaaataccggttttttcagct
cctgagatgcagctgcttgaagacggaagtttcaacaatatcgcatttgccatagcaagg
aaattcatctgcggggagatcccgcccgatcagctcagcgacattatcgacagctgctat
ccgtttgaaaccccgcttgtcgaactggaaaaaggaacctttatcgaggagctgttttct
ggaccgactctggccttcaaggattacggcgcaaggtttctggccaggcttaccggctac
ttcgcatcggaggagcggaagctcatcacggttcttgtcgctacttccggcgataccggc
agtgctgttgcctatggatttcagggaattcagaacaccagggtagtgctgctctacccc
tccggaaaagtaagccgcctgcaggaacagcagctaaccaccgcagggggcaatgtacag
gctctggaagtgcagggcgacttcgacgactgccagcggctggtcaagcaggcgtttacc
gatccggaactgaaggaacggcttaccctgacctcggcaaactccatcaacatatcacgg
ctgattccgcagtcattctattatgcctgggcaacgctgcatctgaaagctcaatacgga
cttgaacagccggtattctcggtaccaagcggaaactatggcaaccttactgcaggcgtt
cttgcccggatgatgggctttcctatcggccacttcatcgcggcatcgaacgccaacgac
agcgtcacccgctatcttgacgagggccgttacgacccccatccgacgatcccgacactt
tctacagccatggatgtcggcaatccgagcaactttgcccggctccggcacttttacgga
aacgaccaccatgccatgggtaaggacatcacgggtatcgcgatttccgatgatgctacc
gtcgctacaatccgcgatattttcaggcgttacggctatgttatcgatccgcacaccgcc
gtaggattccgggcactcgaagagtaccgtcagacaagcgggagccgctcgccgggaata
gttctgtcaacggctcatccggcaaaattcctcgaagtcatcgaggatgcgctggaaaaa
gagatcgaaattccggaacgcctttcggtggtgctcgaaaagaaaaaacaggccgccatg
atcggcaccgattacagagaactcgccgacttccttaaacatctggaacgataa

DBGET integrated database retrieval system