KEGG   Chlorobium limicola: Clim_2414Help
Entry
Clim_2414         CDS       T00766                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cli  Chlorobium limicola
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cli00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cli00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2644223..2645344
Genome map
AA seq 373 aa AA seqDB search
MIQKTLFAALFIFMQLSSLPAQAAAPVDSLSIKIGQMLMIGFRGLTAKAPGIADDIRKRH
IGGVVLFDYDVPLKSPVRNIAGPEQLSKLTRELMDLSEIPLFIALDQEGGKVNRLKTSKG
FPPSVSAAHLGMLDNPDSTTAAARQTAATLKKMHLNMNLAPVLDLNTNSENPVIGKLGRS
YSADPAVVTRHAGLTARVFREEGIIPVFKHFPGHGSSTTDSHKGFTDVTASWTKKEIEPY
RSLIAAGYDDAVMTAHVFNRQLDDRYPATLSQKVLNDRLRSRLRFDGVILSDDMQMKAIA
DQFGLEDAIRLALDAGVDILIFGNNTTFDPAIAEKATAILHELVQNGTVSRARIDRSYRR
IMALKERYLYHCK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaaaaacactctttgccgctctcttcatcttcatgcagctctcttcgcttcca
gcgcaggccgctgctccagttgacagtctttccataaaaatcggccagatgcttatgatc
gggttccgggggctgacagcgaaagcgcccggaatagctgacgatatccgcaagcgtcat
atcggcggcgtggtgctattcgattatgatgtaccattgaaatcaccggtacggaatatc
gctggccccgagcagctgtcgaaactaacgcgtgagctgatggatctttcggaaatcccg
ctgttcatcgcgcttgaccaggaaggcggaaaggtgaaccgtctgaaaacctcaaaggga
tttcccccctcggtttcagctgcacacctcggcatgctcgataacccggacagcacaacc
gccgcagcgcgacagaccgccgcgacgctgaaaaaaatgcacctgaacatgaaccttgcg
ccggtgctcgacctgaacaccaattctgagaatccggtcatcggcaaacttggtcgcagc
tactccgctgatcctgcagtcgtcacgcgtcatgccgggctgacggcgagagtttttcgt
gaagagggaatcattccggtcttcaaacactttccggggcacggcagctcaacaacggac
tcccacaagggcttcacggacgttaccgcaagctggacgaaaaaagagattgaaccgtac
cgttcgttgatcgcggccggctacgacgatgccgtcatgacagctcatgtgttcaacagg
cagcttgacgaccgctatccggccacactttcgcagaaggtactgaacgaccgtctgcgc
agcagactccgcttcgacggagttatcctgagcgatgatatgcagatgaaagccattgcc
gaccagttcggacttgaagatgccatcagactggctctcgatgcaggagtggatatcctg
atctttggcaacaacaccacattcgatcccgcaattgctgaaaaagccacagcaatcctc
catgagcttgtacaaaacggtacggtaagccgagcccgtattgaccgctcctaccggaga
atcatggctctcaaggaacgctacctctaccactgcaaataa

DBGET integrated database retrieval system