KEGG   Chlorobium limicola: Clim_2449Help
Entry
Clim_2449         CDS       T00766                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cli  Chlorobium limicola
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2683807..2684529)
Genome map
AA seq 240 aa AA seqDB search
MIHGFTATPESFAVLEKPLQSLGVPIRMPLLAGHGTPSPEALIGVTFHEWMADAAKAFQQ
LSMEAEKIVIIGHSMGALISLQLAEKYPSTVDSLVLAAPALKLFSLLAPGRLMHFSAPFL
ARIIKKWDIKPVFAGPDYVRCAGQYAWAPTDAILSLFELIVRTSSILDRVRVPVLILHNR
NETTVLPESADHLYRHIGSASDHKKIVWLEHSEHQIFCDCEREKAATAVLDFVADRLGVQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgatccatggttttaccgctacgccggagagttttgcggtgcttgaaaagccgttgcaa
tctcttggcgtcccgatacgcatgccgcttcttgccggtcacggcacaccttcacctgaa
gctctcataggggtaacgtttcacgaatggatggctgatgctgccaaggcatttcagcag
ctttcgatggaagctgaaaagattgtgatcatcggtcacagtatgggagccctgatatct
ctgcagcttgccgagaagtacccgtcaacggtcgattcgcttgttcttgctgcgcccgcc
ttgaagctcttttctttgctcgcaccagggcgtctgatgcatttttccgctccttttctt
gccaggataataaaaaaatgggatatcaaaccggtgtttgccgggccggattatgtccgt
tgtgcagggcagtatgcatgggctccgaccgatgccattctttcgcttttcgagcttatt
gtcagaacctcctcgattcttgaccgtgtgcgagttccggtgcttattctgcataaccgg
aatgaaacgaccgtgcttccggagagcgccgatcatctttaccgccatatcggttcggcc
agtgatcataaaaaaattgtctggctggagcattcggagcatcagattttctgcgactgc
gagagggagaaggccgcaacggcagttttggacttcgttgccgacaggcttggcgttcag
taa

DBGET integrated database retrieval system