KEGG   Clostridium ljungdahlii: CLJU_c01090Help
Entry
CLJU_c01090       CDS       T01276                                 

Definition
(GenBank) predicted hydrolase
Organism
clj  Clostridium ljungdahlii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M18 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADK13207
UniProt: D8GK89
Position
104150..105181
Genome map
AA seq 343 aa AA seqDB search
MEDLDLFKEICETHAPSGREDWLYSIIEDNFNQFGDITISKLNNMYIHKEGKTSRKLMIM
SHADEIFLMVKEITKEGFIKFKGLGIDAKSLVAQEVIIHGKENVSGVVALKYDYSDKQKS
KVSMENLYIETGFCTEKLRSLIKVGDYITLDRKMVGLLNDNVSCKSIDNRASIFAMYVCA
EELKNVNPDLNVYFVCSCQEEVGHRGAKMASYEVKPDIGIALDVTFDGGTLGDSDRENKL
GAGPVICIGPNIHTKIKNRIIQTADKYSIPYQIEVEPGNTGTDAWDIQTAEGGIPTLLIS
IPIKYMHTSVEVVNLKDIKNTGRLLARFIQELKEDELEGLFCF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaggacttagatttattcaaagaaatatgtgaaactcatgcaccaagtggcagagaa
gattggctgtattctattatagaagataattttaaccaatttggagatataactataagt
aagcttaataatatgtatatacataaagaaggaaaaacttctagaaaattaatgataatg
tctcatgcagatgaaatttttttaatggtaaaagaaataacaaaagaaggttttataaaa
tttaaaggattaggaatagatgccaaaagccttgttgctcaagaagttatcattcatgga
aaagaaaatgtatctggagttgtggcgttaaaatatgattatagtgataaacaaaaaagt
aaagttagtatggaaaacctatatatagaaactggtttttgcacagaaaaattaagaagt
ttaattaaggtaggagattatattactttagatagaaaaatggtagggcttttaaatgac
aatgtaagttgtaagtcaatagataacagagctagtatttttgccatgtacgtttgtgcg
gaagaacttaaaaatgtaaatccagatttaaatgtttactttgtgtgttcatgtcaggag
gaagtaggacatagaggagccaaaatggcaagttacgaagttaaacctgatataggtata
gcacttgatgttacttttgatggtggaactttaggggatagcgatagggaaaataagctg
ggagcagggccagttatatgtataggtcctaatatacatactaaaattaaaaataggata
atacaaactgcagataaatatagcattccataccaaattgaagttgagccgggaaacact
ggaactgatgcttgggatattcaaactgcagaagggggaatacctacacttcttatatct
attcctataaagtatatgcatacttctgtagaagtggtaaatttgaaagatatcaaaaac
acaggaagacttttggctaggtttattcaagagttaaaagaggatgaattggagggatta
ttttgcttttag

DBGET integrated database retrieval system