KEGG   Clostridium ljungdahlii: CLJU_c01090Help
Entry
CLJU_c01090       CDS       T01276                                 

Definition
hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
clj  Clostridium ljungdahlii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLJU_c01090
Enzymes [BR:clj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CLJU_c01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
104150..105181
Genome map
AA seq 343 aa AA seqDB search
MEDLDLFKEICETHAPSGREDWLYSIIEDNFNQFGDITISKLNNMYIHKEGKTSRKLMIM
SHADEIFLMVKEITKEGFIKFKGLGIDAKSLVAQEVIIHGKENVSGVVALKYDYSDKQKS
KVSMENLYIETGFCTEKLRSLIKVGDYITLDRKMVGLLNDNVSCKSIDNRASIFAMYVCA
EELKNVNPDLNVYFVCSCQEEVGHRGAKMASYEVKPDIGIALDVTFDGGTLGDSDRENKL
GAGPVICIGPNIHTKIKNRIIQTADKYSIPYQIEVEPGNTGTDAWDIQTAEGGIPTLLIS
IPIKYMHTSVEVVNLKDIKNTGRLLARFIQELKEDELEGLFCF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaggacttagatttattcaaagaaatatgtgaaactcatgcaccaagtggcagagaa
gattggctgtattctattatagaagataattttaaccaatttggagatataactataagt
aagcttaataatatgtatatacataaagaaggaaaaacttctagaaaattaatgataatg
tctcatgcagatgaaatttttttaatggtaaaagaaataacaaaagaaggttttataaaa
tttaaaggattaggaatagatgccaaaagccttgttgctcaagaagttatcattcatgga
aaagaaaatgtatctggagttgtggcgttaaaatatgattatagtgataaacaaaaaagt
aaagttagtatggaaaacctatatatagaaactggtttttgcacagaaaaattaagaagt
ttaattaaggtaggagattatattactttagatagaaaaatggtagggcttttaaatgac
aatgtaagttgtaagtcaatagataacagagctagtatttttgccatgtacgtttgtgcg
gaagaacttaaaaatgtaaatccagatttaaatgtttactttgtgtgttcatgtcaggag
gaagtaggacatagaggagccaaaatggcaagttacgaagttaaacctgatataggtata
gcacttgatgttacttttgatggtggaactttaggggatagcgatagggaaaataagctg
ggagcagggccagttatatgtataggtcctaatatacatactaaaattaaaaataggata
atacaaactgcagataaatatagcattccataccaaattgaagttgagccgggaaacact
ggaactgatgcttgggatattcaaactgcagaagggggaatacctacacttcttatatct
attcctataaagtatatgcatacttctgtagaagtggtaaatttgaaagatatcaaaaac
acaggaagacttttggctaggtttattcaagagttaaaagaggatgaattggagggatta
ttttgcttttag

DBGET integrated database retrieval system